BLASTX nr result
ID: Angelica23_contig00005701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00005701 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974476.1| uncharacterized protein [Arabidopsis thaliana] ... 40 3e-07 >ref|NP_974476.1| uncharacterized protein [Arabidopsis thaliana] gi|332646750|gb|AEE80271.1| uncharacterized protein [Arabidopsis thaliana] Length = 254 Score = 40.4 bits (93), Expect(2) = 3e-07 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = -1 Query: 417 TSVTVNLLNQERNVLI*GSFKDEHFNAGLLLLAFGV 310 T + + L +ER L+ GS++D+HF+AG +LL FGV Sbjct: 151 TELQIQRLTEERKELVKGSYRDKHFDAGSVLLGFGV 186 Score = 38.9 bits (89), Expect(2) = 3e-07 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 317 LESMFDHGGVNTWL*TGKLIPVPHLFAG 234 LE++F GGVNT+L TGKL P PHL+AG Sbjct: 187 LEAVF--GGVNTYLRTGKLFPGPHLYAG 212