BLASTX nr result
ID: Angelica23_contig00005477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00005477 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI21593.1| hypothetical protein [uncultured organism] 45 6e-06 >gb|ABI21593.1| hypothetical protein [uncultured organism] Length = 140 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = -3 Query: 149 SHTHTHLVYIHKHAPYTYSRTAQHRGKVAEERLERDCVTKREIERERE 6 +HTHTH + H H +T++ T H AE ER+ V++RE ERERE Sbjct: 72 THTHTH-THTHTHTTHTHTHTHTHTHTHAERERERERVSERERERERE 118 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 243 HTHTHRIPSLNSNTPRQHKATPTHTDTDTHGITY 142 HTHTH +++TP T THT T TH T+ Sbjct: 49 HTHTHTHTHTHTHTP-----THTHTHTHTHTHTH 77