BLASTX nr result
ID: Angelica23_contig00005411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00005411 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524171.1| PREDICTED: calmodulin-binding transcription ... 76 2e-12 gb|ACU20745.1| unknown [Glycine max] 76 2e-12 ref|XP_002514898.1| calmodulin-binding transcription activator (... 76 3e-12 ref|XP_003532724.1| PREDICTED: calmodulin-binding transcription ... 75 6e-12 gb|AEX07775.1| calmodulin-binding transcription factor SR2L [Sol... 73 3e-11 >ref|XP_003524171.1| PREDICTED: calmodulin-binding transcription activator 4-like [Glycine max] Length = 983 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 473 FRKEKVDVAIDEAVSRVLSMVDSVEAREQYHRMLEKYGQAKAKLEG 336 FRK+KVDV I+EAVSRVLSMVDS +AREQYHRMLEKY QAKA+L G Sbjct: 914 FRKQKVDVEIEEAVSRVLSMVDSPDAREQYHRMLEKYRQAKAELAG 959 >gb|ACU20745.1| unknown [Glycine max] Length = 173 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 473 FRKEKVDVAIDEAVSRVLSMVDSVEAREQYHRMLEKYGQAKAKLEG 336 FRK+KVDV I+EAVSRVLSMVDS +AREQYHRMLEKY QAKA+L G Sbjct: 104 FRKQKVDVEIEEAVSRVLSMVDSPDAREQYHRMLEKYRQAKAELAG 149 >ref|XP_002514898.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223545949|gb|EEF47452.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Length = 924 Score = 75.9 bits (185), Expect = 3e-12 Identities = 42/67 (62%), Positives = 49/67 (73%) Frame = -2 Query: 473 FRKEKVDVAIDEAVSRVLSMVDSVEAREQYHRMLEKYGQAKAKLEGXXXXXXXXXXXSNM 294 FRK+KVD AIDEAVSRVLSMVDS +AR+QYHRMLE+Y AKA+L G +NM Sbjct: 857 FRKQKVDGAIDEAVSRVLSMVDSPDARQQYHRMLERYRLAKAEL-GETSEAVGSGSAANM 915 Query: 293 ENDSSIY 273 END+ Y Sbjct: 916 ENDNIYY 922 >ref|XP_003532724.1| PREDICTED: calmodulin-binding transcription activator 4-like [Glycine max] Length = 995 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 473 FRKEKVDVAIDEAVSRVLSMVDSVEAREQYHRMLEKYGQAKAKLEG 336 FRK+K+DV I+EAVSRVLSMVDS +AREQYHRMLEKY QAKA+L G Sbjct: 926 FRKQKLDVEIEEAVSRVLSMVDSPDAREQYHRMLEKYRQAKAELAG 971 >gb|AEX07775.1| calmodulin-binding transcription factor SR2L [Solanum lycopersicum] Length = 950 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -2 Query: 473 FRKEKVDVAIDEAVSRVLSMVDSVEAREQYHRMLEKYGQAKAKLEG 336 FRK+KVD A+DEAVSRVLSMV+S AR+QYHR+LEKY Q+KA+LEG Sbjct: 892 FRKQKVDAALDEAVSRVLSMVESPGARQQYHRILEKYRQSKAELEG 937