BLASTX nr result
ID: Angelica23_contig00005319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00005319 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637478.1| Ribosome production factor [Medicago truncat... 64 2e-08 ref|XP_003637342.1| Ribosome production factor [Medicago truncat... 64 2e-08 gb|AAC62782.1| F11O4.6 [Arabidopsis thaliana] 63 4e-08 ref|XP_002302686.1| predicted protein [Populus trichocarpa] gi|2... 63 4e-08 dbj|BAJ91910.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 9e-08 >ref|XP_003637478.1| Ribosome production factor [Medicago truncatula] gi|355503413|gb|AES84616.1| Ribosome production factor [Medicago truncatula] Length = 326 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 ECGLHFTLKLKTLQHGTFDTKGGEYEWVHK 90 ECG FTLKLK+LQHGTFDTKGGEYEWVHK Sbjct: 285 ECGPRFTLKLKSLQHGTFDTKGGEYEWVHK 314 >ref|XP_003637342.1| Ribosome production factor [Medicago truncatula] gi|355503277|gb|AES84480.1| Ribosome production factor [Medicago truncatula] Length = 356 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 ECGLHFTLKLKTLQHGTFDTKGGEYEWVHK 90 ECG FTLKLK+LQHGTFDTKGGEYEWVHK Sbjct: 315 ECGPRFTLKLKSLQHGTFDTKGGEYEWVHK 344 >gb|AAC62782.1| F11O4.6 [Arabidopsis thaliana] Length = 434 Score = 62.8 bits (151), Expect = 4e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 ECGLHFTLKLKTLQHGTFDTKGGEYEWVHKV 93 ECG FTLKL TLQHGTFDTKGGE+EWVHKV Sbjct: 322 ECGPRFTLKLVTLQHGTFDTKGGEFEWVHKV 352 >ref|XP_002302686.1| predicted protein [Populus trichocarpa] gi|222844412|gb|EEE81959.1| predicted protein [Populus trichocarpa] Length = 361 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 ECGLHFTLKLKTLQHGTFDTKGGEYEWVHK 90 ECG FTLKL++LQHGTFDTKGGEYEWVHK Sbjct: 320 ECGPRFTLKLRSLQHGTFDTKGGEYEWVHK 349 >dbj|BAJ91910.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 356 Score = 61.6 bits (148), Expect = 9e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 ECGLHFTLKLKTLQHGTFDTKGGEYEWVHK 90 ECG FTLKL+TLQHGTFDTK GEYEWVHK Sbjct: 315 ECGPRFTLKLQTLQHGTFDTKSGEYEWVHK 344