BLASTX nr result
ID: Angelica23_contig00005038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00005038 (500 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64884.1| hypothetical protein VITISV_030620 [Vitis vinifera] 64 1e-08 >emb|CAN64884.1| hypothetical protein VITISV_030620 [Vitis vinifera] Length = 406 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +1 Query: 1 LLMLRTIGILLPIFVMARAFAAVQRRRHLQDIGDFLPAISDEESELPHLQQQPSP 165 LLMLR IGILLP+++M +A A QRRRH QD + LP SDEE+E+P LQ QP P Sbjct: 349 LLMLRAIGILLPVYIMVKACTAFQRRRHQQDARN-LP--SDEENEMPRLQPQPQP 400