BLASTX nr result
ID: Angelica23_contig00004693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00004693 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46115.1| unknown [Medicago truncatula] 87 1e-15 gb|AFK34133.1| unknown [Lotus japonicus] 86 3e-15 ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medi... 86 4e-15 ref|XP_003529363.1| PREDICTED: dolichol-phosphate mannosyltransf... 85 5e-15 ref|XP_002300644.1| predicted protein [Populus trichocarpa] gi|2... 85 5e-15 >gb|AFK46115.1| unknown [Medicago truncatula] Length = 243 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 372 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLVTT 244 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL+TT Sbjct: 201 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLMTT 243 >gb|AFK34133.1| unknown [Lotus japonicus] Length = 243 Score = 85.9 bits (211), Expect = 3e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 372 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLVTT 244 SRKGYHIEEVPITFVDRVYGSSKLGGSEIV+YLKG+VYLLVTT Sbjct: 201 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVQYLKGVVYLLVTT 243 >ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] gi|355486406|gb|AES67609.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] Length = 271 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 372 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLVTT 244 SRKGYHI+EVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL+TT Sbjct: 229 SRKGYHIKEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLMTT 271 >ref|XP_003529363.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Glycine max] Length = 243 Score = 85.1 bits (209), Expect = 5e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 372 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLVTT 244 SRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGL YLLVTT Sbjct: 201 SRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 243 >ref|XP_002300644.1| predicted protein [Populus trichocarpa] gi|222842370|gb|EEE79917.1| predicted protein [Populus trichocarpa] Length = 240 Score = 85.1 bits (209), Expect = 5e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 372 SRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLVTT 244 SRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGL YLLVTT Sbjct: 198 SRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 240