BLASTX nr result
ID: Angelica23_contig00002002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00002002 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517071.1| acireductone dioxygenase, putative [Ricinus ... 77 1e-12 ref|XP_002311641.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 gb|AFU51538.1| acireductone dioxygenase [Capsicum annuum] 74 1e-11 gb|AAR03591.1| ARD-like protein [Brassica juncea] 74 2e-11 gb|AAW23951.1| ARD/ARD family protein 2 [Brassica juncea] 74 2e-11 >ref|XP_002517071.1| acireductone dioxygenase, putative [Ricinus communis] gi|223543706|gb|EEF45234.1| acireductone dioxygenase, putative [Ricinus communis] Length = 200 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 286 IKAMRLFVGDPVWTPFNRPHDHLPARKEYLESFVQK 179 IKAMRLFVGDP+WTPFNRPHDHLPARKEY+++FVQK Sbjct: 154 IKAMRLFVGDPIWTPFNRPHDHLPARKEYIKAFVQK 189 >ref|XP_002311641.1| predicted protein [Populus trichocarpa] gi|222851461|gb|EEE89008.1| predicted protein [Populus trichocarpa] Length = 200 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 286 IKAMRLFVGDPVWTPFNRPHDHLPARKEYLESFVQK 179 IKAMRLFVGDPVWTPFNRPHDHLPARKEY+++FV K Sbjct: 154 IKAMRLFVGDPVWTPFNRPHDHLPARKEYVQAFVSK 189 >gb|AFU51538.1| acireductone dioxygenase [Capsicum annuum] Length = 200 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 286 IKAMRLFVGDPVWTPFNRPHDHLPARKEYLESFV 185 IKAMRLFVGDPVWTP+NRPHDHLPARKEY+E+FV Sbjct: 154 IKAMRLFVGDPVWTPYNRPHDHLPARKEYVETFV 187 >gb|AAR03591.1| ARD-like protein [Brassica juncea] Length = 195 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -2 Query: 286 IKAMRLFVGDPVWTPFNRPHDHLPARKEYLESFVQK 179 IKAMRLFVG+PVWTP+NRPHDHLPARKEY+++FV+K Sbjct: 154 IKAMRLFVGEPVWTPYNRPHDHLPARKEYVDNFVKK 189 >gb|AAW23951.1| ARD/ARD family protein 2 [Brassica juncea] Length = 59 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -2 Query: 286 IKAMRLFVGDPVWTPFNRPHDHLPARKEYLESFVQK 179 IKAMRLFVG+PVWTP+NRPHDHLPARKEY+++FV+K Sbjct: 18 IKAMRLFVGEPVWTPYNRPHDHLPARKEYVDNFVKK 53