BLASTX nr result
ID: Angelica23_contig00000248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00000248 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG34275.1| polygalacturonase [Eucalyptus globulus subsp. glo... 147 7e-34 ref|XP_002301370.1| predicted protein [Populus trichocarpa] gi|2... 144 6e-33 ref|XP_002876618.1| glycoside hydrolase family 28 protein [Arabi... 143 1e-32 ref|NP_191708.1| polygalacturonase-like protein [Arabidopsis tha... 143 1e-32 ref|XP_003633958.1| PREDICTED: probable polygalacturonase-like [... 142 4e-32 >gb|ABG34275.1| polygalacturonase [Eucalyptus globulus subsp. globulus] Length = 238 Score = 147 bits (372), Expect = 7e-34 Identities = 70/81 (86%), Positives = 76/81 (93%) Frame = +3 Query: 3 ISYGMPTKQLSIKRLTCISPYSAAIALGSEMSGGIEDVRAEDITAINTESGVRIKTGVGR 182 ISYGMPTKQL I+RLTCISPYSA IALGSEMSGGIEDVRAEDITAINTESG+RIKT +GR Sbjct: 37 ISYGMPTKQLVIRRLTCISPYSAMIALGSEMSGGIEDVRAEDITAINTESGIRIKTAMGR 96 Query: 183 GGYVKDIFVKGMNLHTMKWVF 245 GGYVKDI+V+GM +HTMKW F Sbjct: 97 GGYVKDIYVRGMKMHTMKWAF 117 >ref|XP_002301370.1| predicted protein [Populus trichocarpa] gi|222843096|gb|EEE80643.1| predicted protein [Populus trichocarpa] Length = 470 Score = 144 bits (364), Expect = 6e-33 Identities = 70/81 (86%), Positives = 76/81 (93%) Frame = +3 Query: 3 ISYGMPTKQLSIKRLTCISPYSAAIALGSEMSGGIEDVRAEDITAINTESGVRIKTGVGR 182 I++GMPTKQL I+RLTCISPYSA IALGSEMSGGIEDVRAEDITAI+TESGVRIKT VGR Sbjct: 265 IAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIEDVRAEDITAIHTESGVRIKTAVGR 324 Query: 183 GGYVKDIFVKGMNLHTMKWVF 245 GGYVKDI+VK M +HTMKWVF Sbjct: 325 GGYVKDIYVKRMTMHTMKWVF 345 >ref|XP_002876618.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. lyrata] gi|297322456|gb|EFH52877.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. lyrata] Length = 475 Score = 143 bits (361), Expect = 1e-32 Identities = 70/81 (86%), Positives = 75/81 (92%) Frame = +3 Query: 3 ISYGMPTKQLSIKRLTCISPYSAAIALGSEMSGGIEDVRAEDITAINTESGVRIKTGVGR 182 IS+GMPTK L I+RLTCISPYSAAIALGSEMSGGIEDVRAEDITA TESGVRIKT VGR Sbjct: 267 ISFGMPTKHLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAYQTESGVRIKTAVGR 326 Query: 183 GGYVKDIFVKGMNLHTMKWVF 245 G +VK+I+VKGMNLHTMKWVF Sbjct: 327 GAFVKNIYVKGMNLHTMKWVF 347 >ref|NP_191708.1| polygalacturonase-like protein [Arabidopsis thaliana] gi|42572755|ref|NP_974473.1| polygalacturonase-like protein [Arabidopsis thaliana] gi|334186188|ref|NP_001190154.1| polygalacturonase-like protein [Arabidopsis thaliana] gi|6850840|emb|CAB71079.1| putative protein [Arabidopsis thaliana] gi|332646690|gb|AEE80211.1| polygalacturonase-like protein [Arabidopsis thaliana] gi|332646691|gb|AEE80212.1| polygalacturonase-like protein [Arabidopsis thaliana] gi|332646692|gb|AEE80213.1| polygalacturonase-like protein [Arabidopsis thaliana] Length = 476 Score = 143 bits (361), Expect = 1e-32 Identities = 70/81 (86%), Positives = 75/81 (92%) Frame = +3 Query: 3 ISYGMPTKQLSIKRLTCISPYSAAIALGSEMSGGIEDVRAEDITAINTESGVRIKTGVGR 182 IS+GMPTK L I+RLTCISPYSAAIALGSEMSGGIEDVRAEDITA TESGVRIKT VGR Sbjct: 267 ISFGMPTKHLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAYQTESGVRIKTAVGR 326 Query: 183 GGYVKDIFVKGMNLHTMKWVF 245 G +VK+I+VKGMNLHTMKWVF Sbjct: 327 GAFVKNIYVKGMNLHTMKWVF 347 >ref|XP_003633958.1| PREDICTED: probable polygalacturonase-like [Vitis vinifera] Length = 479 Score = 142 bits (357), Expect = 4e-32 Identities = 66/81 (81%), Positives = 75/81 (92%) Frame = +3 Query: 3 ISYGMPTKQLSIKRLTCISPYSAAIALGSEMSGGIEDVRAEDITAINTESGVRIKTGVGR 182 I+YGMPTKQL I+RLTCISPYSA IALGSEMSGGI+DVRAEDI AIN+ESG+RIKTG+GR Sbjct: 273 IAYGMPTKQLVIRRLTCISPYSAVIALGSEMSGGIQDVRAEDIVAINSESGIRIKTGIGR 332 Query: 183 GGYVKDIFVKGMNLHTMKWVF 245 GGYVKDI+V+GM + TMKW F Sbjct: 333 GGYVKDIYVRGMTMKTMKWAF 353