BLASTX nr result
ID: Angelica22_contig00050802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00050802 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520537.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002520537.1| conserved hypothetical protein [Ricinus communis] gi|223540379|gb|EEF41950.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/73 (41%), Positives = 38/73 (52%) Frame = -3 Query: 248 QREIHSGAQFLADSASLHVNSSRLPGSQFVTKPGFDPKKFALTCNYCKKTGHTVDKCYKP 69 QR IH+ +Q L D+A + V K +L C +C KT H +KCYK Sbjct: 8 QRSIHAQSQVLNDAAEMAVKKG----------------KSSLYCTHCSKTWHLKEKCYKL 51 Query: 68 HGFPADFKFTKSK 30 GFPA+FKFTK K Sbjct: 52 IGFPANFKFTKVK 64 Database: ./nr Posted date: Mar 14, 2013 10:53 AM Number of letters in database: 8,123,359,852 Number of sequences in database: 23,641,837 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 23641837 Number of Hits to DB: 566,229,923,740,049 Number of extensions: 681670000 Number of successful extensions: -790598605 Number of sequences better than 1.0e-05: 101789341 Number of HSP's gapped: -1177529597 Number of HSP's successfully gapped: 137386327 Length of database: 8,123,359,852 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 28 (15.4 bits)