BLASTX nr result
ID: Angelica22_contig00050080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00050080 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulg... 58 7e-07 >ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435156|ref|YP_004222374.1| hypothetical protein BevumaM_p141 [Beta vulgaris subsp. maritima] gi|346683248|ref|YP_004842180.1| hypothetical protein BemaM_p136 [Beta macrocarpa] gi|9049301|dbj|BAA99311.1| orf100a [Beta vulgaris subsp. vulgaris] gi|317905607|emb|CBJ14013.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439889|emb|CBJ17589.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148044|emb|CBJ20707.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500166|emb|CBX24985.1| hypothetical protein [Beta macrocarpa] gi|384977908|emb|CBL54132.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 100 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/57 (43%), Positives = 41/57 (71%) Frame = +1 Query: 49 SHTHQLAQPLHIVLPDGSIKQVHTTGSIILNSKITLSDVFYIPEFKHNLLSVAKLLD 219 S+ L + + + LPDGS+K V+ G++ ++ +TL+ V Y+ +FKHNLLSV+KLL+ Sbjct: 30 SNVRTLRKEIRVGLPDGSVKTVNEVGNVKISPNVTLTGVLYVNDFKHNLLSVSKLLE 86