BLASTX nr result
ID: Angelica22_contig00049955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049955 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 70 2e-10 ref|YP_004222690.1| hypothetical chloroplast RF21 [Anthriscus ce... 70 2e-10 gb|ABU85175.1| hypothetical protein RF2 [Anethum graveolens] 70 2e-10 ref|YP_740161.1| hypothetical protein RF2 [Daucus carota] gi|114... 70 2e-10 ref|YP_004891654.1| unnamed protein product (chloroplast) [Nicot... 70 2e-10 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653955|ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11873|emb|CAA77388.1| hypothetical protein [Nicotiana tabacum] gi|1223685|emb|CAA77405.1| hypothetical protein [Nicotiana tabacum] gi|77799611|dbj|BAE46700.1| hypothetical protein [Nicotiana sylvestris] gi|77799641|dbj|BAE46730.1| hypothetical protein [Nicotiana sylvestris] gi|80750973|dbj|BAE48049.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751003|dbj|BAE48079.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453933|gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453981|gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454044|gb|AEO95701.1| hypothetical protein [synthetic construct] gi|347454090|gb|AEO95747.1| hypothetical protein [synthetic construct] gi|225244|prf||1211235CC ORF 115 Length = 115 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 284 EYMLQQESHKGRLETSGKMPARNPADKVHYIVR 186 EYMLQQESHKGRLETSGKMPARNPADKVHYIV+ Sbjct: 58 EYMLQQESHKGRLETSGKMPARNPADKVHYIVQ 90 >ref|YP_004222690.1| hypothetical chloroplast RF21 [Anthriscus cerefolium] gi|323149144|ref|YP_004222707.1| hypothetical chloroplast RF21 [Anthriscus cerefolium] gi|289645619|gb|ADD13682.1| hypothetical chloroplast RF21 [Anthriscus cerefolium] gi|289645637|gb|ADD13700.1| hypothetical chloroplast RF21 [Anthriscus cerefolium] Length = 2102 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP 92 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP Sbjct: 2073 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP 2102 >gb|ABU85175.1| hypothetical protein RF2 [Anethum graveolens] Length = 2092 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP 92 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP Sbjct: 2063 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP 2092 >ref|YP_740161.1| hypothetical protein RF2 [Daucus carota] gi|114107195|ref|YP_740178.1| hypothetical protein RF2 [Daucus carota] gi|122246291|sp|Q0G9Q1.1|YCF2_DAUCA RecName: Full=Protein ycf2 gi|113200951|gb|ABI32467.1| hypothetical protein RF2 [Daucus carota] gi|113200970|gb|ABI32486.1| hypothetical protein RF2 [Daucus carota] Length = 2091 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP 92 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP Sbjct: 2062 KRWLFPDEMKIGFMEQEKDFPFLSRKVMWP 2091 >ref|YP_004891654.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653956|ref|YP_004891683.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11872|emb|CAA77387.1| hypothetical protein [Nicotiana tabacum] gi|1223686|emb|CAA77406.1| hypothetical protein [Nicotiana tabacum] gi|77799612|dbj|BAE46701.1| hypothetical protein [Nicotiana sylvestris] gi|77799642|dbj|BAE46731.1| hypothetical protein [Nicotiana sylvestris] gi|80750974|dbj|BAE48050.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751004|dbj|BAE48080.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453934|gb|AEO95592.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453982|gb|AEO95640.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454045|gb|AEO95702.1| hypothetical protein [synthetic construct] gi|347454091|gb|AEO95748.1| hypothetical protein [synthetic construct] gi|225245|prf||1211235CD ORF 92 Length = 92 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +2 Query: 176 AP*NGLCNVLYLLGCGRAFYQRFLIYPCVIPVEAYT 283 +P GLCNVLYLLG GRAFYQRFLIYPCVIPVEAYT Sbjct: 4 SPIPGLCNVLYLLGYGRAFYQRFLIYPCVIPVEAYT 39