BLASTX nr result
ID: Angelica22_contig00049908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049908 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34116.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_002525881.1| pentatricopeptide repeat-containing protein,... 60 2e-07 ref|XP_002514422.1| pentatricopeptide repeat-containing protein,... 56 3e-06 >emb|CBI34116.3| unnamed protein product [Vitis vinifera] Length = 727 Score = 67.0 bits (162), Expect = 1e-09 Identities = 40/106 (37%), Positives = 59/106 (55%), Gaps = 3/106 (2%) Frame = +2 Query: 2 SYFYKLREHGFRHSYCTYFAIVKILCCKGMVRMLSTVLSEIVELSDSDSFGFEVSELFDE 181 S+F +L+E GF+H+ TY A++++LC + R L ++LSEIV +S GF+++ LFD Sbjct: 82 SFFTQLKESGFQHNVDTYAALIRVLCRWRLERKLQSLLSEIVGSKES-VLGFDITALFDV 140 Query: 182 LSE---EFKDEDQEXXXXXXXXXXXXXXXXERFDEAIDTIFRTKRR 310 L E E + E FDEAID +F+TKRR Sbjct: 141 LREGGGEVEGEHSSVLILVLDMLVKAYVRVGMFDEAIDALFQTKRR 186 >ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Vitis vinifera] Length = 817 Score = 67.0 bits (162), Expect = 1e-09 Identities = 40/106 (37%), Positives = 59/106 (55%), Gaps = 3/106 (2%) Frame = +2 Query: 2 SYFYKLREHGFRHSYCTYFAIVKILCCKGMVRMLSTVLSEIVELSDSDSFGFEVSELFDE 181 S+F +L+E GF+H+ TY A++++LC + R L ++LSEIV +S GF+++ LFD Sbjct: 82 SFFTQLKESGFQHNVDTYAALIRVLCRWRLERKLQSLLSEIVGSKES-VLGFDITALFDV 140 Query: 182 LSE---EFKDEDQEXXXXXXXXXXXXXXXXERFDEAIDTIFRTKRR 310 L E E + E FDEAID +F+TKRR Sbjct: 141 LREGGGEVEGEHSSVLILVLDMLVKAYVRVGMFDEAIDALFQTKRR 186 >ref|XP_002525881.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534795|gb|EEF36485.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 913 Score = 59.7 bits (143), Expect = 2e-07 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 5/108 (4%) Frame = +2 Query: 2 SYFYKLREHGFRHSYCTYFAIVKILCCKGMVRMLSTVLSEIVELSDSDS-FGFEVSELFD 178 S+F +L++ GF+H TY AI++ILC G+ + L ++ +I+ +S +D+ FE+S D Sbjct: 85 SFFNQLKDSGFKHDISTYAAIIRILCYWGLHKQLRSIFLDIIYVSCNDNDTPFEISHFLD 144 Query: 179 ELSEEFKDEDQE----XXXXXXXXXXXXXXXXERFDEAIDTIFRTKRR 310 LS+ F D D + FD+AID +F+ RR Sbjct: 145 TLSDGFVDVDSKKQSLFMSKVYDALVKAYVSVGMFDDAIDVLFQMGRR 192 >ref|XP_002514422.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546418|gb|EEF47918.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 809 Score = 55.8 bits (133), Expect = 3e-06 Identities = 33/101 (32%), Positives = 49/101 (48%) Frame = +2 Query: 2 SYFYKLREHGFRHSYCTYFAIVKILCCKGMVRMLSTVLSEIVELSDSDSFGFEVSELFDE 181 SYF +L+E G+ H TY AIV+ILC G R L ++L EI++ + FG + LF+ Sbjct: 78 SYFNQLKESGYSHDPYTYAAIVRILCFWGWSRKLDSILMEIIKKDGNLDFG--IVNLFEA 135 Query: 182 LSEEFKDEDQEXXXXXXXXXXXXXXXXERFDEAIDTIFRTK 304 L + +E FD+A D + +TK Sbjct: 136 LGDGIANESFSVLVQVSDALIKVCVASGMFDQAFDVLLQTK 176