BLASTX nr result
ID: Angelica22_contig00049896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049896 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273940.1| PREDICTED: uncharacterized protein LOC100255... 65 9e-11 ref|XP_002299363.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-08 ref|XP_002303737.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002512700.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 >ref|XP_002273940.1| PREDICTED: uncharacterized protein LOC100255664 [Vitis vinifera] Length = 272 Score = 64.7 bits (156), Expect(2) = 9e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 6 LVFEFLKHKICNSESVYIGKKTTALSEDDQLQLGHDYFLLP 128 L+ EF KH++C+S+S YIG+K ALSEDD+LQLGH YFLLP Sbjct: 59 LMLEFPKHRVCHSDSFYIGQKIPALSEDDELQLGHKYFLLP 99 Score = 26.6 bits (57), Expect(2) = 9e-11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 113 LLPPSNYFFDSPLPFVTITSFAAAVS 190 LLP +FF S L FVT+ SFA++ S Sbjct: 97 LLP--KHFFQSVLSFVTVASFASSQS 120 >ref|XP_002299363.1| predicted protein [Populus trichocarpa] gi|222846621|gb|EEE84168.1| predicted protein [Populus trichocarpa] Length = 267 Score = 59.3 bits (142), Expect(2) = 3e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 6 LVFEFLKHKICNSESVYIGKKTTALSEDDQLQLGHDYFLLP 128 L+ EF KH +C+S+S YIG+K ALSE+D LQLGH YFLLP Sbjct: 57 LMVEFPKHLVCHSDSFYIGQKIPALSENDLLQLGHKYFLLP 97 Score = 23.1 bits (48), Expect(2) = 3e-08 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 113 LLPPSNYFFDSPLPFVTITSFAAA 184 LLP + F S L FVTI SFA++ Sbjct: 95 LLP--KHCFQSVLSFVTIASFASS 116 >ref|XP_002303737.1| predicted protein [Populus trichocarpa] gi|222841169|gb|EEE78716.1| predicted protein [Populus trichocarpa] Length = 272 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 6 LVFEFLKHKICNSESVYIGKKTTALSEDDQLQLGHDYFLLP 128 L+ EF KH +C+S+S YIG+K ALSE+DQLQLGH YFLLP Sbjct: 58 LMVEFPKHLVCHSDSFYIGQKIPALSENDQLQLGHKYFLLP 98 >ref|XP_002512700.1| conserved hypothetical protein [Ricinus communis] gi|223548661|gb|EEF50152.1| conserved hypothetical protein [Ricinus communis] Length = 274 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 6 LVFEFLKHKICNSESVYIGKKTTALSEDDQLQLGHDYFLLP 128 L+ E+ KH +C S+S YIG+K ALSE+DQLQLGH YFLLP Sbjct: 57 LLHEYPKHLVCRSDSFYIGQKIPALSENDQLQLGHKYFLLP 97