BLASTX nr result
ID: Angelica22_contig00049889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049889 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002465815.1| hypothetical protein SORBIDRAFT_01g046340 [S... 45 1e-06 ref|XP_002462720.1| hypothetical protein SORBIDRAFT_02g030860 [S... 45 1e-06 ref|XP_003635424.1| PREDICTED: LOW QUALITY PROTEIN: putative rib... 39 2e-06 ref|XP_002533065.1| conserved hypothetical protein [Ricinus comm... 47 3e-06 gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold ... 39 4e-06 >ref|XP_002465815.1| hypothetical protein SORBIDRAFT_01g046340 [Sorghum bicolor] gi|241919669|gb|EER92813.1| hypothetical protein SORBIDRAFT_01g046340 [Sorghum bicolor] Length = 1028 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 5/64 (7%) Frame = +2 Query: 38 GTENEDYLYWSKENSGSYSVRSAYRIFHA*KDVWRI-----EDNDGLWRKMWRTKAPQRC 202 G ++D+ W+ E +G YSVRSAY++ + K W + GLW+ +W+ + P + Sbjct: 913 GRNSQDFWAWNSEKTGVYSVRSAYKLLYNKKFGWNQNLAPGSSSVGLWKMLWKLQVPPKV 972 Query: 203 LILF 214 + + Sbjct: 973 RVFW 976 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 190 PPKVLNFIWRALSNILPTRTVLHQKFVPLMCTC 288 PPKV F WR ++ LP R VL +K + + C Sbjct: 969 PPKVRVFWWRVANDFLPARQVLFKKHIEPVAFC 1001 >ref|XP_002462720.1| hypothetical protein SORBIDRAFT_02g030860 [Sorghum bicolor] gi|241926097|gb|EER99241.1| hypothetical protein SORBIDRAFT_02g030860 [Sorghum bicolor] Length = 438 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 5/64 (7%) Frame = +2 Query: 38 GTENEDYLYWSKENSGSYSVRSAYRIFHA*KDVWRI-----EDNDGLWRKMWRTKAPQRC 202 G ++D+ W+ E +G YSVRSAY++ + K W + GLW+ +W+ + P + Sbjct: 141 GRNSQDFWAWNSEKTGVYSVRSAYKLLYNKKFGWNQNLAPGSSSVGLWKMLWKLQVPPKV 200 Query: 203 LILF 214 + + Sbjct: 201 RVFW 204 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 190 PPKVLNFIWRALSNILPTRTVLHQKFVPLMCTC 288 PPKV F WR ++ LP R VL +K + + C Sbjct: 197 PPKVRVFWWRVANDFLPARQVLFKKHIEPVAFC 229 >ref|XP_003635424.1| PREDICTED: LOW QUALITY PROTEIN: putative ribonuclease H protein At1g65750-like [Vitis vinifera] Length = 820 Score = 38.5 bits (88), Expect(2) = 2e-06 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +1 Query: 190 PPKVLNFIWRALSNILPTRTVLHQKFV--PLMC-TCR 291 PPK+LNF WRA N LPTR L + V P+ C CR Sbjct: 517 PPKILNFAWRAARNCLPTRFALTIRHVDTPMCCPICR 553 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = +2 Query: 2 RDQSCIRNIVLNGTENEDYLYWSKENSGSYSVRSAYRIFHA*KD----VWRIEDNDGLWR 169 RD I +I L + ED + WS + G Y+ RS Y + V D++ +W Sbjct: 450 RDADLILSIPLPMSSREDQISWSFDARGEYTARSGYGALRCFRQSTALVASDVDSNFVWA 509 Query: 170 KMWRTKAPQRCL 205 ++W+ AP + L Sbjct: 510 QLWKVTAPPKIL 521 >ref|XP_002533065.1| conserved hypothetical protein [Ricinus communis] gi|223527129|gb|EEF29304.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 47.4 bits (111), Expect(2) = 3e-06 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = +2 Query: 2 RDQSCIRNIVLNGTENEDYLYWSKENSGSYSVRSAYRIFHA*KDVWRIEDNDG-LWRKMW 178 RD+ I NIVL+ D +YW ++ G++SVR AYR+ D+ D +W K+W Sbjct: 120 RDKRLIHNIVLSHVAELDRVYWHRDVKGNFSVRDAYRLQQ--HDLSSSYSGDSVVWSKLW 177 Query: 179 RTKAPQRCLI 208 R +C I Sbjct: 178 RLNITSKCKI 187 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 208 FIWRALSNILPTRTVLHQK 264 F+WRAL NILPTR L K Sbjct: 188 FMWRALLNILPTRVNLVTK 206 >gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 612 Score = 39.3 bits (90), Expect(2) = 4e-06 Identities = 22/63 (34%), Positives = 26/63 (41%) Frame = +2 Query: 11 SCIRNIVLNGTENEDYLYWSKENSGSYSVRSAYRIFHA*KDVWRIEDNDGLWRKMWRTKA 190 S I N L D + W EN G YSVRSAY + G W +WR K Sbjct: 210 SAIINTPLFSKVQHDRIIWKAENDGKYSVRSAYTLCVEELIDTSFLRRPGYWSDIWRLKV 269 Query: 191 PQR 199 P + Sbjct: 270 PPK 272 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 184 KGPPKVLNFIWRALSNILPTRTVLHQKFVPLMCTC 288 K PPK+ NF+WR +LPTR L K V C Sbjct: 268 KVPPKIKNFMWRVCRGVLPTRNKLRDKGVQCPEAC 302