BLASTX nr result
ID: Angelica22_contig00049731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049731 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_11037278.1| hypothetical protein HMPREF9241_00001 [Actino... 91 1e-16 ref|ZP_06580273.1| LOW QUALITY PROTEIN: retrotransposon protein ... 86 4e-15 ref|ZP_06589594.1| retrotransposon protein [Streptomyces albus J... 86 4e-15 ref|ZP_06577425.1| retrotransposon protein [Streptomyces ghanaen... 82 4e-14 ref|ZP_04997890.1| retrotransposon protein [Streptomyces sp. Mg1... 80 2e-13 >ref|ZP_11037278.1| hypothetical protein HMPREF9241_00001 [Actinomyces turicensis ACS-279-V-Col4] gi|405980290|ref|ZP_11038629.1| hypothetical protein HMPREF9241_01352 [Actinomyces turicensis ACS-279-V-Col4] gi|405980542|ref|ZP_11038880.1| hypothetical protein HMPREF9241_01603 [Actinomyces turicensis ACS-279-V-Col4] gi|404389952|gb|EJZ85023.1| hypothetical protein HMPREF9241_01603 [Actinomyces turicensis ACS-279-V-Col4] gi|404390283|gb|EJZ85352.1| hypothetical protein HMPREF9241_01352 [Actinomyces turicensis ACS-279-V-Col4] gi|404393425|gb|EJZ88479.1| hypothetical protein HMPREF9241_00001 [Actinomyces turicensis ACS-279-V-Col4] Length = 92 Score = 90.9 bits (224), Expect = 1e-16 Identities = 50/71 (70%), Positives = 57/71 (80%) Frame = +2 Query: 2 GVKGQSNTVIAGSPRNAFRCSVAWFLLEVEHWMV*GAYRLTEISQTPNAGKCSVAVRRRG 181 GVKGQSN+VIAGSPRNAFRCSV L+EVE A +T++SQTPNA + S+AVR RG Sbjct: 19 GVKGQSNSVIAGSPRNAFRCSVVCCLVEVELLDGRWALWVTDVSQTPNAIRLSMAVRLRG 78 Query: 182 ISFVVERETAQ 214 ISFVVERETAQ Sbjct: 79 ISFVVERETAQ 89 >ref|ZP_06580273.1| LOW QUALITY PROTEIN: retrotransposon protein [Streptomyces ghanaensis ATCC 14672] gi|291343778|gb|EFE70734.1| LOW QUALITY PROTEIN: retrotransposon protein [Streptomyces ghanaensis ATCC 14672] Length = 53 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +2 Query: 2 GVKGQSNTVIAGSPRNAFRCSVAWFLLEVEHWMV*GAYRLTEISQTPNAGK 154 GVKGQSN+VIAGSPRNAFRCSV FL EVEHW+ G YR+T++SQTPNAGK Sbjct: 3 GVKGQSNSVIAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAGK 53 >ref|ZP_06589594.1| retrotransposon protein [Streptomyces albus J1074] gi|291452125|ref|ZP_06591515.1| retrotransposon protein [Streptomyces albus J1074] gi|294628254|ref|ZP_06706814.1| hypothetical protein SSTG_00254 [Streptomyces sp. e14] gi|297202787|ref|ZP_06920184.1| retrotransposon protein [Streptomyces sviceus ATCC 29083] gi|291353153|gb|EFE80055.1| retrotransposon protein [Streptomyces albus J1074] gi|291355074|gb|EFE81976.1| retrotransposon protein [Streptomyces albus J1074] gi|292831587|gb|EFF89936.1| hypothetical protein SSTG_00254 [Streptomyces sp. e14] gi|297148195|gb|EFH28879.1| retrotransposon protein [Streptomyces sviceus ATCC 29083] Length = 54 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +2 Query: 2 GVKGQSNTVIAGSPRNAFRCSVAWFLLEVEHWMV*GAYRLTEISQTPNAGK 154 GVKGQSN+VIAGSPRNAFRCSV FL EVEHW+ G YR+T++SQTPNAGK Sbjct: 4 GVKGQSNSVIAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAGK 54 >ref|ZP_06577425.1| retrotransposon protein [Streptomyces ghanaensis ATCC 14672] gi|291340930|gb|EFE67886.1| retrotransposon protein [Streptomyces ghanaensis ATCC 14672] Length = 50 Score = 82.0 bits (201), Expect = 4e-14 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +2 Query: 5 VKGQSNTVIAGSPRNAFRCSVAWFLLEVEHWMV*GAYRLTEISQTPNAGK 154 +KGQSN+VIAGSPRNAFRCSV FL EVEHW+ G YR+T++SQTPNAGK Sbjct: 1 MKGQSNSVIAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAGK 50 >ref|ZP_04997890.1| retrotransposon protein [Streptomyces sp. Mg1] gi|194341435|gb|EDX22401.1| retrotransposon protein [Streptomyces sp. Mg1] Length = 56 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +2 Query: 8 KGQSNTVIAGSPRNAFRCSVAWFLLEVEHWMV*GAYRLTEISQTPNAGK 154 +GQSN+VIAGSPRNAFRCSV FL EVEHW+ G YR+T++SQTPNAGK Sbjct: 8 EGQSNSVIAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAGK 56