BLASTX nr result
ID: Angelica22_contig00049536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049536 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317809.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002321370.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002317060.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002525813.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002265121.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinif... 59 3e-07 >ref|XP_002317809.1| predicted protein [Populus trichocarpa] gi|222858482|gb|EEE96029.1| predicted protein [Populus trichocarpa] Length = 523 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = +2 Query: 134 MGKNNIAGGNSWLDVVKKAFRSPTKSN--KSGKRREEHEQEDDEKKRGK 274 MGK GG+SWL VK+AFRSP+K N +S +RRE+HEQE++EKKRGK Sbjct: 1 MGK---IGGSSWLSAVKRAFRSPSKENDKRSSRRREDHEQEEEEKKRGK 46 >ref|XP_002321370.1| predicted protein [Populus trichocarpa] gi|222868366|gb|EEF05497.1| predicted protein [Populus trichocarpa] Length = 243 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = +2 Query: 155 GGNSWLDVVKKAFRSPTKSN--KSGKRREEHEQEDDEKKRGK 274 GG+SWL+ VK+AFRSP+K N KS +RRE HEQE++EKKRGK Sbjct: 5 GGSSWLNAVKRAFRSPSKENDKKSSRRREVHEQEEEEKKRGK 46 >ref|XP_002317060.1| predicted protein [Populus trichocarpa] gi|222860125|gb|EEE97672.1| predicted protein [Populus trichocarpa] Length = 552 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = +2 Query: 134 MGKNNIAGGNSWLDVVKKAFRSPTKSN--KSGKRREEHEQEDDEKKRGK 274 MGK GG SWL +VK+AFRSP+K N KS +RREEH+QE++EKKR K Sbjct: 1 MGKK---GGTSWLTIVKRAFRSPSKENEKKSSRRREEHDQEEEEKKREK 46 >ref|XP_002525813.1| conserved hypothetical protein [Ricinus communis] gi|223534877|gb|EEF36565.1| conserved hypothetical protein [Ricinus communis] Length = 526 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +2 Query: 158 GNSWLDVVKKAFRSPTKSN--KSGKRREEHEQEDDEKKRGK 274 G+SWL VK+AFRSPTK N +S +RRE+ EQED+EKKRGK Sbjct: 6 GSSWLAAVKRAFRSPTKDNSKRSSRRREDQEQEDEEKKRGK 46 >ref|XP_002265121.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera] gi|296089000|emb|CBI38703.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = +2 Query: 134 MGKNNIAGGNSWLDVVKKAFRSPTK--SNKSGKRREEHEQEDDEKKR 268 MGK GG+SWL VK+AFRSPTK +SG+RREEH+QE+DE+K+ Sbjct: 1 MGKK---GGSSWLTAVKRAFRSPTKETDKRSGRRREEHDQEEDEEKK 44