BLASTX nr result
ID: Angelica22_contig00049533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049533 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30521.3| unnamed protein product [Vitis vinifera] 48 2e-07 >emb|CBI30521.3| unnamed protein product [Vitis vinifera] Length = 943 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +1 Query: 88 YKKVKYGDYLLNSMKSKMEGKTHTEM 165 YKKV+YGDYL +SMK KMEGK HTEM Sbjct: 577 YKKVRYGDYLRHSMKRKMEGKFHTEM 602 Score = 32.3 bits (72), Expect(2) = 2e-07 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +2 Query: 2 SLAAFLFPNLDKEIEPFDCMVKSQ*MLKNTRK 97 S A+F+ P+ D EIEPFD +V SQ +K +K Sbjct: 548 SFASFILPHDDVEIEPFDHLVDSQQPIKIYKK 579