BLASTX nr result
ID: Angelica22_contig00049530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049530 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ43368.1| AlaT1 [Vitis labrusca] 59 4e-07 gb|AAZ43369.1| AlaT1 [Vitis vinifera] 59 4e-07 ref|XP_003635112.1| PREDICTED: alanine aminotransferase 2 isofor... 59 4e-07 ref|XP_002273994.1| PREDICTED: alanine aminotransferase 2 isofor... 59 4e-07 emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera] 59 4e-07 >gb|AAZ43368.1| AlaT1 [Vitis labrusca] Length = 477 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 255 MSTKGLDYESLNENVKKTQYAVRGELYIRALEL 353 MS KGLDYE+LNENVKK QYAVRGELY+RA EL Sbjct: 1 MSHKGLDYETLNENVKKVQYAVRGELYLRASEL 33 >gb|AAZ43369.1| AlaT1 [Vitis vinifera] Length = 484 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 255 MSTKGLDYESLNENVKKTQYAVRGELYIRALEL 353 MS KGLDYE+LNENVKK QYAVRGELY+RA EL Sbjct: 1 MSHKGLDYETLNENVKKVQYAVRGELYLRASEL 33 >ref|XP_003635112.1| PREDICTED: alanine aminotransferase 2 isoform 2 [Vitis vinifera] Length = 487 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 255 MSTKGLDYESLNENVKKTQYAVRGELYIRALEL 353 MS KGLDYE+LNENVKK QYAVRGELY+RA EL Sbjct: 1 MSHKGLDYETLNENVKKVQYAVRGELYLRASEL 33 >ref|XP_002273994.1| PREDICTED: alanine aminotransferase 2 isoform 1 [Vitis vinifera] gi|296083415|emb|CBI23368.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 255 MSTKGLDYESLNENVKKTQYAVRGELYIRALEL 353 MS KGLDYE+LNENVKK QYAVRGELY+RA EL Sbjct: 1 MSHKGLDYETLNENVKKVQYAVRGELYLRASEL 33 >emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera] Length = 481 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 255 MSTKGLDYESLNENVKKTQYAVRGELYIRALEL 353 MS KGLDYE+LNENVKK QYAVRGELY+RA EL Sbjct: 1 MSHKGLDYETLNENVKKVQYAVRGELYLRASEL 33