BLASTX nr result
ID: Angelica22_contig00049459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049459 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus c... 56 4e-06 ref|NP_196138.1| uncharacterized protein [Arabidopsis thaliana] ... 55 6e-06 >ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus communis] gi|223540017|gb|EEF41595.1| hypothetical protein RCOM_0690150 [Ricinus communis] Length = 878 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -1 Query: 106 MTSQMTTKVRFVRCPRCLLVLPESADVPVYECGGC 2 M+S+ + K+R VRCP+C +LPE DVPVYECGGC Sbjct: 1 MSSRTSPKIRLVRCPKCRHILPELPDVPVYECGGC 35 >ref|NP_196138.1| uncharacterized protein [Arabidopsis thaliana] gi|75170629|sp|Q9FHK4.1|Y5519_ARATH RecName: Full=Uncharacterized protein At5g05190 gi|9759260|dbj|BAB09695.1| unnamed protein product [Arabidopsis thaliana] gi|20466820|gb|AAM20727.1| putative protein [Arabidopsis thaliana] gi|30725434|gb|AAP37739.1| At5g05190 [Arabidopsis thaliana] gi|332003456|gb|AED90839.1| uncharacterized protein [Arabidopsis thaliana] Length = 615 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -1 Query: 106 MTSQMTTKVRFVRCPRCLLVLPESADVPVYECGGC 2 M SQ K+R VRCP+CL +L E DVPVY+CGGC Sbjct: 1 MASQTGQKIRLVRCPKCLKILQEDEDVPVYQCGGC 35