BLASTX nr result
ID: Angelica22_contig00049413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049413 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulg... 71 1e-10 gb|AAT40486.1| putative polyprotein [Solanum demissum] 68 9e-10 gb|AAC33963.1| contains similarity to reverse transcriptases (Pf... 67 2e-09 emb|CAB40067.1| putative retrotransposon polyprotein [Arabidopsi... 67 2e-09 emb|CAN59936.1| hypothetical protein VITISV_001878 [Vitis vinifera] 66 3e-09 >ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435156|ref|YP_004222374.1| hypothetical protein BevumaM_p141 [Beta vulgaris subsp. maritima] gi|346683248|ref|YP_004842180.1| hypothetical protein BemaM_p136 [Beta macrocarpa] gi|9049301|dbj|BAA99311.1| orf100a [Beta vulgaris subsp. vulgaris] gi|317905607|emb|CBJ14013.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439889|emb|CBJ17589.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148044|emb|CBJ20707.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500166|emb|CBX24985.1| hypothetical protein [Beta macrocarpa] gi|384977908|emb|CBL54132.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 100 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/75 (41%), Positives = 50/75 (66%) Frame = +2 Query: 110 ASWIIDTGASDHMAFNSMLFSDIHDTPSPITICLPNGTLMLVDKIVNVMLTSNIVLHNVL 289 ++W+ID+GASDH N + S++ I + LP+G++ V+++ NV ++ N+ L VL Sbjct: 10 SAWLIDSGASDHFTGNKEIMSNVRTLRKEIRVGLPDGSVKTVNEVGNVKISPNVTLTGVL 69 Query: 290 YVPDFKHNILYVGKI 334 YV DFKHN+L V K+ Sbjct: 70 YVNDFKHNLLSVSKL 84 >gb|AAT40486.1| putative polyprotein [Solanum demissum] Length = 1065 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/73 (45%), Positives = 49/73 (67%) Frame = +2 Query: 116 WIIDTGASDHMAFNSMLFSDIHDTPSPITICLPNGTLMLVDKIVNVMLTSNIVLHNVLYV 295 WI+DTGAS HM+ ++ LF+D+ D P P + LPNG+ + + V+LT + LH+VLYV Sbjct: 334 WIVDTGASHHMSGDAQLFNDLCDVP-PYLVSLPNGSTTIASMEI-VILTDKMKLHHVLYV 391 Query: 296 PDFKHNILYVGKI 334 P K N++ V K+ Sbjct: 392 PQLKCNLIVVSKL 404 >gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, score: 11.19) [Arabidopsis thaliana] Length = 1633 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/74 (41%), Positives = 49/74 (66%) Frame = +2 Query: 104 TSASWIIDTGASDHMAFNSMLFSDIHDTPSPITICLPNGTLMLVDKIVNVMLTSNIVLHN 283 +S +WIID+GAS H+ + +F ++ S +T+ LPNGT + + + +TS ++LHN Sbjct: 393 SSDAWIIDSGASSHVCSDLTMFRELIHV-SGVTVTLPNGTRVAITHTGTICITSTLILHN 451 Query: 284 VLYVPDFKHNILYV 325 VL VPDFK N++ V Sbjct: 452 VLLVPDFKFNLISV 465 >emb|CAB40067.1| putative retrotransposon polyprotein [Arabidopsis thaliana] gi|7267797|emb|CAB81200.1| putative retrotransposon polyprotein [Arabidopsis thaliana] Length = 1203 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/74 (41%), Positives = 49/74 (66%) Frame = +2 Query: 104 TSASWIIDTGASDHMAFNSMLFSDIHDTPSPITICLPNGTLMLVDKIVNVMLTSNIVLHN 283 +S +WIID+GAS H+ + +F ++ S +T+ LPNGT + + + +TS ++LHN Sbjct: 95 SSDAWIIDSGASSHVCSDLTMFRELIHV-SGVTVTLPNGTRVAITHTGTICITSTLILHN 153 Query: 284 VLYVPDFKHNILYV 325 VL VPDFK N++ V Sbjct: 154 VLLVPDFKFNLISV 167 >emb|CAN59936.1| hypothetical protein VITISV_001878 [Vitis vinifera] Length = 1031 Score = 65.9 bits (159), Expect = 3e-09 Identities = 39/104 (37%), Positives = 60/104 (57%) Frame = +2 Query: 23 SDNLQHSSVNFAGIVSAFQVDLVDTHNTSASWIIDTGASDHMAFNSMLFSDIHDTPSPIT 202 S+ LQ S NF GI+S T N S WI+D+GA+ H+ NS +F IH S T Sbjct: 346 SNPLQQSISNFTGILSLSPSS--STLNPSI-WILDSGATHHVCTNSSMFHSIHSFSSN-T 401 Query: 203 ICLPNGTLMLVDKIVNVMLTSNIVLHNVLYVPDFKHNILYVGKI 334 + LP GT + + I + L+ ++VL +VLY+P F+ N++ + + Sbjct: 402 VTLPTGTKIPITGIGTIHLSPHLVLEHVLYIPTFQFNLISISAL 445