BLASTX nr result
ID: Angelica22_contig00049288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049288 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524160.1| conserved hypothetical protein [Ricinus comm... 122 4e-26 ref|XP_002524154.1| conserved hypothetical protein [Ricinus comm... 122 4e-26 ref|XP_002519802.1| conserved hypothetical protein [Ricinus comm... 120 1e-25 ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [S... 112 3e-23 gb|AFW57694.1| putative WD40-like beta propeller repeat family p... 108 3e-22 >ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis] gi|223536578|gb|EEF38223.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 122 bits (305), Expect = 4e-26 Identities = 50/75 (66%), Positives = 60/75 (80%) Frame = +3 Query: 3 EDIKKNENVKDFKRITHSRYQNSLASWTMFSTDDPNSVWNLQFNGEYTPSCPYAPPSGAE 182 +DI KN++VK F RITHSRY+NS +WTMFST+DPN+ WNL YTPSCPYA P G E Sbjct: 650 DDINKNKDVKKFNRITHSRYENSTPTWTMFSTEDPNATWNLLLKDSYTPSCPYAYPDGGE 709 Query: 183 TWHMSGHLCIPQRNC 227 +WHM+GHLCIP+R C Sbjct: 710 SWHMTGHLCIPKRCC 724 >ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis] gi|223536572|gb|EEF38217.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 122 bits (305), Expect = 4e-26 Identities = 50/75 (66%), Positives = 60/75 (80%) Frame = +3 Query: 3 EDIKKNENVKDFKRITHSRYQNSLASWTMFSTDDPNSVWNLQFNGEYTPSCPYAPPSGAE 182 +DI KN++VK F RITHSRY+NS +WTMFST+DPN+ WNL YTPSCPYA P G E Sbjct: 650 DDINKNKDVKKFNRITHSRYENSTPTWTMFSTEDPNATWNLLLKDSYTPSCPYAYPDGGE 709 Query: 183 TWHMSGHLCIPQRNC 227 +WHM+GHLCIP+R C Sbjct: 710 SWHMTGHLCIPRRCC 724 >ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis] gi|223541041|gb|EEF42598.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 120 bits (301), Expect = 1e-25 Identities = 49/74 (66%), Positives = 59/74 (79%) Frame = +3 Query: 6 DIKKNENVKDFKRITHSRYQNSLASWTMFSTDDPNSVWNLQFNGEYTPSCPYAPPSGAET 185 DI KN++VK F RITHSRY+NS +WTMFST+DPN+ WN+ YTPSCPYA P G E+ Sbjct: 651 DINKNKDVKKFNRITHSRYENSTPTWTMFSTEDPNAEWNMHLTDSYTPSCPYAYPDGGES 710 Query: 186 WHMSGHLCIPQRNC 227 WHM+GHLCIP+R C Sbjct: 711 WHMTGHLCIPKRCC 724 >ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor] gi|241937228|gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor] Length = 730 Score = 112 bits (280), Expect = 3e-23 Identities = 46/76 (60%), Positives = 61/76 (80%), Gaps = 1/76 (1%) Frame = +3 Query: 3 EDIKKNENVKDFKRITHSRYQNSLASWTMFSTDDPNSVWNLQFNGE-YTPSCPYAPPSGA 179 +D +KN++VK F R+THSRY+ S +WTMF+TDDPN+ WN+ N + YTP+CPYA P G Sbjct: 655 DDARKNKDVKKFHRVTHSRYEYSTPAWTMFATDDPNAQWNMLVNKDSYTPACPYAYPDGG 714 Query: 180 ETWHMSGHLCIPQRNC 227 E+WHM+GHLCIP+R C Sbjct: 715 ESWHMTGHLCIPRRCC 730 >gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea mays] Length = 730 Score = 108 bits (271), Expect = 3e-22 Identities = 45/76 (59%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Frame = +3 Query: 3 EDIKKNENVKDFKRITHSRYQNSLASWTMFSTDDPNSVWNLQFNGE-YTPSCPYAPPSGA 179 ED KN++VK F R+THSRY+ S +WT+F+TDDPN+ WN+ + YTP+CPYA P G Sbjct: 655 EDASKNKDVKKFHRVTHSRYEYSTPTWTVFATDDPNAQWNMLVKKDSYTPACPYAYPDGG 714 Query: 180 ETWHMSGHLCIPQRNC 227 E+WHM+GHLCIP+R C Sbjct: 715 ESWHMTGHLCIPRRCC 730