BLASTX nr result
ID: Angelica22_contig00049230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049230 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449474033|ref|XP_004154055.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449510921|ref|XP_004163811.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] Length = 649 Score = 56.6 bits (135), Expect = 2e-06 Identities = 36/71 (50%), Positives = 42/71 (59%), Gaps = 6/71 (8%) Frame = +3 Query: 57 HLPKTLTRHCTR------FFTHPSRLPSHIPTGTNHLIQSHCQQGNLKQALYLLSQEPNL 218 H P + R+ T F +PS P+ + NHLIQS C+QGNLKQALYLLS E N Sbjct: 11 HYPPSSPRYSTSKLSVSSFSFNPSTPPN---SNNNHLIQSLCKQGNLKQALYLLSHESNP 67 Query: 219 NIQTFELLIHS 251 QT ELLI S Sbjct: 68 TQQTCELLILS 78