BLASTX nr result
ID: Angelica22_contig00049126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049126 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF79254.1|AC023279_3 F12K21.6 [Arabidopsis thaliana] 57 2e-06 gb|AAD03367.1| putative retroelement pol polyprotein [Arabidopsi... 55 6e-06 gb|AAR13317.1| gag-pol polyprotein [Phaseolus vulgaris] 55 8e-06 >gb|AAF79254.1|AC023279_3 F12K21.6 [Arabidopsis thaliana] Length = 755 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = -1 Query: 282 NWEGPYRVRAVLWEGTYYLADMEGKSIPRAWNMEHLKKYY 163 NWEGPY + ++ Y LAD+ GK++PR+WN HL+KYY Sbjct: 715 NWEGPYLISKIVRPEVYELADLSGKAVPRSWNAMHLRKYY 754 >gb|AAD03367.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1329 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = -1 Query: 282 NWEGPYRVRAVLWEGTYYLADMEGKSIPRAWNMEHLKKYY 163 +WEGPY++ V+ G Y L +MEGK++ RAWN HLK++Y Sbjct: 1289 SWEGPYKITHVVRNGVYRLINMEGKTVRRAWNSMHLKRFY 1328 >gb|AAR13317.1| gag-pol polyprotein [Phaseolus vulgaris] Length = 1859 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -1 Query: 285 ANWEGPYRVRAVLWEGTYYLADMEGKSIPRAWNMEHLKKYY 163 +NWEGP+R+ G YYL + GKS PR WN HLK YY Sbjct: 1818 SNWEGPFRISNTATGGAYYLEYLSGKSAPRTWNATHLKFYY 1858