BLASTX nr result
ID: Angelica22_contig00049062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00049062 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527368.1| SAB, putative [Ricinus communis] gi|22353328... 97 2e-18 ref|XP_003634489.1| PREDICTED: uncharacterized protein LOC100254... 95 5e-18 emb|CBI19286.3| unnamed protein product [Vitis vinifera] 95 5e-18 ref|XP_002285638.1| PREDICTED: uncharacterized protein LOC100254... 95 5e-18 ref|XP_002301119.1| predicted protein [Populus trichocarpa] gi|2... 92 4e-17 >ref|XP_002527368.1| SAB, putative [Ricinus communis] gi|223533287|gb|EEF35040.1| SAB, putative [Ricinus communis] Length = 2626 Score = 96.7 bits (239), Expect = 2e-18 Identities = 48/75 (64%), Positives = 59/75 (78%), Gaps = 5/75 (6%) Frame = -3 Query: 273 FVLRTMRGEADSKQQGEWSDNDAEFSPYARQLTITKTKKLIRRHTKKLRSKGKKGTG--- 103 FVLRTMRGEA++ GEWS++DAEFSP+ARQLTITK K+LIRRHTKKLRS+G+KG Sbjct: 2523 FVLRTMRGEAENDFHGEWSESDAEFSPFARQLTITKAKRLIRRHTKKLRSRGQKGASSQQ 2582 Query: 102 --ALSLSPDDMSPIE 64 +L SP + +P E Sbjct: 2583 KESLPSSPRETTPFE 2597 >ref|XP_003634489.1| PREDICTED: uncharacterized protein LOC100254031 isoform 2 [Vitis vinifera] Length = 2618 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/70 (64%), Positives = 56/70 (80%) Frame = -3 Query: 273 FVLRTMRGEADSKQQGEWSDNDAEFSPYARQLTITKTKKLIRRHTKKLRSKGKKGTGALS 94 FVLRTMRGEAD++ QGEWS++D EFSP+ARQLTITK K+L+RRHTKK RS+G+KG+ + Sbjct: 2528 FVLRTMRGEADNEFQGEWSESDVEFSPFARQLTITKAKRLLRRHTKKFRSRGQKGSSSQQ 2587 Query: 93 LSPDDMSPIE 64 SP E Sbjct: 2588 RESLPSSPRE 2597 >emb|CBI19286.3| unnamed protein product [Vitis vinifera] Length = 2465 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/70 (64%), Positives = 56/70 (80%) Frame = -3 Query: 273 FVLRTMRGEADSKQQGEWSDNDAEFSPYARQLTITKTKKLIRRHTKKLRSKGKKGTGALS 94 FVLRTMRGEAD++ QGEWS++D EFSP+ARQLTITK K+L+RRHTKK RS+G+KG+ + Sbjct: 2375 FVLRTMRGEADNEFQGEWSESDVEFSPFARQLTITKAKRLLRRHTKKFRSRGQKGSSSQQ 2434 Query: 93 LSPDDMSPIE 64 SP E Sbjct: 2435 RESLPSSPRE 2444 >ref|XP_002285638.1| PREDICTED: uncharacterized protein LOC100254031 isoform 1 [Vitis vinifera] Length = 2641 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/70 (64%), Positives = 56/70 (80%) Frame = -3 Query: 273 FVLRTMRGEADSKQQGEWSDNDAEFSPYARQLTITKTKKLIRRHTKKLRSKGKKGTGALS 94 FVLRTMRGEAD++ QGEWS++D EFSP+ARQLTITK K+L+RRHTKK RS+G+KG+ + Sbjct: 2551 FVLRTMRGEADNEFQGEWSESDVEFSPFARQLTITKAKRLLRRHTKKFRSRGQKGSSSQQ 2610 Query: 93 LSPDDMSPIE 64 SP E Sbjct: 2611 RESLPSSPRE 2620 >ref|XP_002301119.1| predicted protein [Populus trichocarpa] gi|222842845|gb|EEE80392.1| predicted protein [Populus trichocarpa] Length = 382 Score = 92.0 bits (227), Expect = 4e-17 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 5/75 (6%) Frame = -3 Query: 273 FVLRTMRGEADSKQQGEWSDNDAEFSPYARQLTITKTKKLIRRHTKKLRSKGKKGTG--- 103 FVLRTMRGEA++ GEWS++DAEFSP+ARQLTITK K+LI+RHTKK RS+G+K + Sbjct: 293 FVLRTMRGEAENDFHGEWSESDAEFSPFARQLTITKAKRLIKRHTKKFRSRGQKASSSQQ 352 Query: 102 --ALSLSPDDMSPIE 64 +L SP + +P E Sbjct: 353 RESLPSSPRESTPFE 367