BLASTX nr result
ID: Angelica22_contig00048705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048705 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526713.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002526713.1| conserved hypothetical protein [Ricinus communis] gi|223533946|gb|EEF35670.1| conserved hypothetical protein [Ricinus communis] Length = 496 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/74 (43%), Positives = 46/74 (62%) Frame = +3 Query: 3 NGLGAQSRPMLDAASGGALWAKSYEEAYELIEMMAANEYQNPTQRLPQGKVAGVLEVDTA 182 +GL +R M+DAA+GGAL K+ E+A LIE MA N Q + R G+ V +VD+ Sbjct: 31 SGLNLATRQMVDAAAGGALNNKTPEQAQNLIEEMAMNNNQWQSSRSRPGRQGVVNQVDST 90 Query: 183 TAIAAQLKALTMKV 224 A+AAQ++ L K+ Sbjct: 91 AALAAQVELLAKKI 104