BLASTX nr result
ID: Angelica22_contig00048493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048493 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173490.1| hypothetical protein NitaMp153 [Nicotiana tabac... 145 3e-33 ref|YP_004222249.1| hypothetical protein BevumaM_p010 [Beta vulg... 141 5e-32 >ref|YP_173490.1| hypothetical protein NitaMp153 [Nicotiana tabacum] gi|56806655|dbj|BAD83556.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 109 Score = 145 bits (367), Expect = 3e-33 Identities = 70/75 (93%), Positives = 72/75 (96%) Frame = -3 Query: 227 LPVVPSSPLAV*AGCPSLLRSVRLWITGTNVIEWNSRRVTRSTVPRCEVQVVMITPGYAL 48 LPVVPSSPLAV AGCPSLLRS +LWI GTNV+EWNSRRVTRSTVPRCEVQVVMITPGYAL Sbjct: 21 LPVVPSSPLAVWAGCPSLLRSFKLWIKGTNVVEWNSRRVTRSTVPRCEVQVVMITPGYAL 80 Query: 47 APLTGTPEPANAREN 3 APLTGTPEPANAREN Sbjct: 81 APLTGTPEPANAREN 95 >ref|YP_004222249.1| hypothetical protein BevumaM_p010 [Beta vulgaris subsp. maritima] gi|346683127|ref|YP_004842056.1| hypothetical protein BemaM_p008 [Beta macrocarpa] gi|317905687|emb|CBX33234.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439767|emb|CBX33286.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320147999|emb|CBJ20665.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500045|emb|CBX24861.1| hypothetical protein [Beta macrocarpa] gi|384939224|emb|CBL52070.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 145 Score = 141 bits (356), Expect = 5e-32 Identities = 68/75 (90%), Positives = 72/75 (96%) Frame = -3 Query: 227 LPVVPSSPLAV*AGCPSLLRSVRLWITGTNVIEWNSRRVTRSTVPRCEVQVVMITPGYAL 48 LPVVPSSPLAV AGCPSLLRSVRLWI GTNV++W+S+RVTRSTVPRCEVQVVMITPGYAL Sbjct: 36 LPVVPSSPLAVWAGCPSLLRSVRLWIRGTNVVKWDSKRVTRSTVPRCEVQVVMITPGYAL 95 Query: 47 APLTGTPEPANAREN 3 APLTGTP PANAREN Sbjct: 96 APLTGTPGPANAREN 110