BLASTX nr result
ID: Angelica22_contig00048484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048484 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB68539.1| (S)-reticuline oxidase-like protein [Daucus carota] 177 6e-43 ref|XP_002523167.1| Reticuline oxidase precursor, putative [Rici... 98 8e-19 ref|XP_003526387.1| PREDICTED: reticuline oxidase-like protein-l... 97 1e-18 ref|XP_003638116.1| Reticuline oxidase [Medicago truncatula] gi|... 97 1e-18 ref|XP_003638113.1| Reticuline oxidase [Medicago truncatula] gi|... 93 3e-17 >dbj|BAB68539.1| (S)-reticuline oxidase-like protein [Daucus carota] Length = 506 Score = 177 bits (450), Expect = 6e-43 Identities = 85/103 (82%), Positives = 93/103 (90%) Frame = +3 Query: 3 KTVRFVFQSLYLGKVDTLLPIMQEYFPELGLKREDCLETSWIQTAPLFSNFTVGTDPKIL 182 KTVRFVFQ LYLGK+DTLLPIMQ+YFPELGL R+DC ETSWI+TAP+FS F VGTDP IL Sbjct: 282 KTVRFVFQCLYLGKIDTLLPIMQKYFPELGLVRDDCTETSWIKTAPMFSGFPVGTDPTIL 341 Query: 183 LNKTAIRRDIVKIRSSFATQPISLEGLNGIWDLWLQQPVQTML 311 LNKTAI R+ VKI+SSF TQPISLEGLNGIWDLWL+QPVQT L Sbjct: 342 LNKTAIPRNSVKIKSSFTTQPISLEGLNGIWDLWLKQPVQTTL 384 >ref|XP_002523167.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537574|gb|EEF39198.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 525 Score = 97.8 bits (242), Expect = 8e-19 Identities = 44/98 (44%), Positives = 68/98 (69%) Frame = +3 Query: 6 TVRFVFQSLYLGKVDTLLPIMQEYFPELGLKREDCLETSWIQTAPLFSNFTVGTDPKILL 185 T R +F+SL+LG++D L+P+M E FPELGLK EDC E SWI++A F+ + G+ P++LL Sbjct: 297 TFRVIFESLFLGRIDALIPLMNESFPELGLKAEDCTEMSWIESAVSFAAYPKGSPPEVLL 356 Query: 186 NKTAIRRDIVKIRSSFATQPISLEGLNGIWDLWLQQPV 299 +KT + + K +S F T+PI +GL G+ L++ + Sbjct: 357 DKTQLYKANFKAKSDFVTEPIPEDGLEGMRKRLLEEDI 394 >ref|XP_003526387.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max] Length = 529 Score = 97.1 bits (240), Expect = 1e-18 Identities = 44/103 (42%), Positives = 63/103 (61%) Frame = +3 Query: 3 KTVRFVFQSLYLGKVDTLLPIMQEYFPELGLKREDCLETSWIQTAPLFSNFTVGTDPKIL 182 KT + F+SL+LG +D L+P+M FPELGL+ EDC E SWIQ+ FS + G P++L Sbjct: 295 KTFQATFESLFLGGIDRLIPLMNASFPELGLQAEDCTEMSWIQSVLFFSGYNKGDSPEVL 354 Query: 183 LNKTAIRRDIVKIRSSFATQPISLEGLNGIWDLWLQQPVQTML 311 LN+T + K +S F +PI GL GIW + ++ +L Sbjct: 355 LNRTTTYKSSFKAKSDFVKEPIPKTGLEGIWKMLQEEETLALL 397 >ref|XP_003638116.1| Reticuline oxidase [Medicago truncatula] gi|355504051|gb|AES85254.1| Reticuline oxidase [Medicago truncatula] Length = 541 Score = 97.1 bits (240), Expect = 1e-18 Identities = 45/93 (48%), Positives = 64/93 (68%) Frame = +3 Query: 6 TVRFVFQSLYLGKVDTLLPIMQEYFPELGLKREDCLETSWIQTAPLFSNFTVGTDPKILL 185 TV+ +FQ+L+LG VD L+P+M+E FPELGL REDC+E SWI++ F G P++LL Sbjct: 305 TVQALFQALFLGSVDKLIPLMKEKFPELGLVREDCIEMSWIESVLYLYGFPKGESPEMLL 364 Query: 186 NKTAIRRDIVKIRSSFATQPISLEGLNGIWDLW 284 N+T +DI K++S F PIS GL +W ++ Sbjct: 365 NRTQAAKDIFKVKSDFVRIPISEIGLERMWRMF 397 >ref|XP_003638113.1| Reticuline oxidase [Medicago truncatula] gi|355504048|gb|AES85251.1| Reticuline oxidase [Medicago truncatula] Length = 543 Score = 92.8 bits (229), Expect = 3e-17 Identities = 47/102 (46%), Positives = 63/102 (61%) Frame = +3 Query: 6 TVRFVFQSLYLGKVDTLLPIMQEYFPELGLKREDCLETSWIQTAPLFSNFTVGTDPKILL 185 TV +FQSL+LG VD LLP+M+E FPELGL REDC+E SWI++ F G + LL Sbjct: 307 TVLALFQSLFLGSVDNLLPLMEEKFPELGLVREDCVEMSWIESVLYLFRFPEGEPLETLL 366 Query: 186 NKTAIRRDIVKIRSSFATQPISLEGLNGIWDLWLQQPVQTML 311 N+T +D K +S F PI GL G+W L+ + + +L Sbjct: 367 NRTLAAKDNSKAKSDFVKIPIPETGLEGLWPLFDEDGAEDVL 408