BLASTX nr result
ID: Angelica22_contig00048379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048379 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320413.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 ref|XP_003540984.1| PREDICTED: uncharacterized protein LOC100808... 97 1e-18 ref|XP_002528543.1| conserved hypothetical protein [Ricinus comm... 96 3e-18 ref|XP_003526221.1| PREDICTED: uncharacterized protein LOC100812... 94 9e-18 ref|XP_002276750.2| PREDICTED: uncharacterized protein LOC100245... 92 6e-17 >ref|XP_002320413.1| predicted protein [Populus trichocarpa] gi|222861186|gb|EEE98728.1| predicted protein [Populus trichocarpa] Length = 692 Score = 97.4 bits (241), Expect = 1e-18 Identities = 46/74 (62%), Positives = 56/74 (75%) Frame = -3 Query: 250 KDDHSLPKIPTLPSYKSELKSGPIRNAGTVPFVWEQCPGKPKDESKSRNCANQSPVITPK 71 K D +L +I P YKSELKSGP+RN GTVPFVWE+ PG+PKDESK +N A Q P I PK Sbjct: 32 KTDDALSRISPPPVYKSELKSGPLRNPGTVPFVWERSPGRPKDESKPQNRALQRPPIAPK 91 Query: 70 LPPGRTMEMKKQTS 29 LPPGR ++ ++Q S Sbjct: 92 LPPGRILKDQQQAS 105 >ref|XP_003540984.1| PREDICTED: uncharacterized protein LOC100808447 [Glycine max] Length = 416 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/74 (58%), Positives = 56/74 (75%) Frame = -3 Query: 250 KDDHSLPKIPTLPSYKSELKSGPIRNAGTVPFVWEQCPGKPKDESKSRNCANQSPVITPK 71 K D +PK P LP YKSELKSGP+ N GTVPFVWE+ PG+PK+ESK + A + P + PK Sbjct: 37 KPDKPVPKRPPLPFYKSELKSGPVTNPGTVPFVWEKTPGRPKNESKQQTQAVERPSVAPK 96 Query: 70 LPPGRTMEMKKQTS 29 LPPGR +++++Q S Sbjct: 97 LPPGRVLKVEQQDS 110 >ref|XP_002528543.1| conserved hypothetical protein [Ricinus communis] gi|223532045|gb|EEF33855.1| conserved hypothetical protein [Ricinus communis] Length = 607 Score = 95.9 bits (237), Expect = 3e-18 Identities = 42/73 (57%), Positives = 55/73 (75%) Frame = -3 Query: 253 EKDDHSLPKIPTLPSYKSELKSGPIRNAGTVPFVWEQCPGKPKDESKSRNCANQSPVITP 74 +K +++ K+P LP YKSELKSGP+RN GTVPFVWE+ PGKPK E K + A Q P + P Sbjct: 37 KKTENAFSKVPPLPKYKSELKSGPVRNPGTVPFVWERSPGKPKCEIKPQTVALQQPPMIP 96 Query: 73 KLPPGRTMEMKKQ 35 KLPPGR + +++Q Sbjct: 97 KLPPGRMLNVERQ 109 >ref|XP_003526221.1| PREDICTED: uncharacterized protein LOC100812760 [Glycine max] Length = 417 Score = 94.4 bits (233), Expect = 9e-18 Identities = 43/74 (58%), Positives = 56/74 (75%) Frame = -3 Query: 250 KDDHSLPKIPTLPSYKSELKSGPIRNAGTVPFVWEQCPGKPKDESKSRNCANQSPVITPK 71 K D S+ K P LP YKSELKSGP+ N GTVPFVWE+ PG+PK+ESK + A + P + PK Sbjct: 37 KADKSVRKRPPLPFYKSELKSGPVTNPGTVPFVWEKTPGRPKNESKLQTRAVERPSVAPK 96 Query: 70 LPPGRTMEMKKQTS 29 LPPGR +++++Q S Sbjct: 97 LPPGRVLKVEQQCS 110 >ref|XP_002276750.2| PREDICTED: uncharacterized protein LOC100245463 [Vitis vinifera] Length = 678 Score = 91.7 bits (226), Expect = 6e-17 Identities = 44/72 (61%), Positives = 52/72 (72%) Frame = -3 Query: 250 KDDHSLPKIPTLPSYKSELKSGPIRNAGTVPFVWEQCPGKPKDESKSRNCANQSPVITPK 71 K+D SL I LP+YKSELKSGP+RN G VPF+WEQ PG+PKDESK Q P TPK Sbjct: 32 KNDSSLSNILPLPTYKSELKSGPVRNPGAVPFIWEQTPGRPKDESKP-----QIPPTTPK 86 Query: 70 LPPGRTMEMKKQ 35 LPPGR + K++ Sbjct: 87 LPPGRILNTKQR 98