BLASTX nr result
ID: Angelica22_contig00048373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048373 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277740.1| PREDICTED: RING-H2 finger protein ATL29 [Vit... 64 2e-08 ref|XP_002527665.1| RING-H2 finger protein ATL3B precursor, puta... 61 8e-08 >ref|XP_002277740.1| PREDICTED: RING-H2 finger protein ATL29 [Vitis vinifera] Length = 281 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = +3 Query: 63 CRCFLHRVAHSWRLRHNPAATSVGPGSAATAKGLDPEIIKAFPCFMYSTVKEYRRE 230 CRCF+ ++H+W L +P+ T GPG ++ GLDP II +FP F+YSTVK+YR + Sbjct: 40 CRCFMGNLSHTW-LGRSPSGTH-GPGGSSAVHGLDPSIIDSFPTFVYSTVKDYREQ 93 >ref|XP_002527665.1| RING-H2 finger protein ATL3B precursor, putative [Ricinus communis] gi|223532970|gb|EEF34736.1| RING-H2 finger protein ATL3B precursor, putative [Ricinus communis] Length = 266 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/56 (42%), Positives = 36/56 (64%) Frame = +3 Query: 63 CRCFLHRVAHSWRLRHNPAATSVGPGSAATAKGLDPEIIKAFPCFMYSTVKEYRRE 230 CRCF+ + SW LR P+ ++ ++ GLDP +I+ FP F YS+V+E+RRE Sbjct: 29 CRCFMDGIVSSWHLRRTPSGNAINATNSPANSGLDPSLIQLFPTFGYSSVREFRRE 84