BLASTX nr result
ID: Angelica22_contig00048183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048183 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635079.1| PREDICTED: uncharacterized protein LOC100852... 62 6e-08 ref|XP_002524361.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_003635079.1| PREDICTED: uncharacterized protein LOC100852443 [Vitis vinifera] gi|297745672|emb|CBI40926.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/67 (50%), Positives = 42/67 (62%) Frame = -3 Query: 208 GGSSSRRAELLDYSRRLRDSAPNTPKHHHQNKPPSVSSIIQQPINQIMAAQSKRKQAKAP 29 G SRRA LL YS+ LR+SA + P ++SS QQPIN+I A QSK K K P Sbjct: 56 GRGYSRRALLLHYSQSLRESAQSAASA--SLNPKAISSKDQQPINKIAAGQSKPKHEKVP 113 Query: 28 ACMGNWK 8 AC+G+WK Sbjct: 114 ACLGDWK 120 >ref|XP_002524361.1| conserved hypothetical protein [Ricinus communis] gi|223536322|gb|EEF37972.1| conserved hypothetical protein [Ricinus communis] Length = 192 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/69 (44%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = -3 Query: 208 GGSSSRRAELLDYSRRLRDSAPNTP--KHHHQNKPPSVSSIIQQPINQIMAAQSKRKQAK 35 G SRRA+LL YS+RLR+SA + P H P +SS + QP I Q K K Sbjct: 69 GKGFSRRAQLLLYSQRLRESADHRPVESSHLDPIPKPISSNVMQPTENIAVVQRKPKYDN 128 Query: 34 APACMGNWK 8 PAC+G WK Sbjct: 129 TPACLGKWK 137