BLASTX nr result
ID: Angelica22_contig00048171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048171 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containi... 112 3e-23 ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containi... 109 2e-22 ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 105 3e-21 ref|XP_003623530.1| Pentatricopeptide repeat-containing protein ... 105 3e-21 ref|XP_002533822.1| pentatricopeptide repeat-containing protein,... 103 2e-20 >ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Vitis vinifera] Length = 505 Score = 112 bits (280), Expect = 3e-23 Identities = 57/103 (55%), Positives = 76/103 (73%) Frame = -3 Query: 309 RGWLEMVPDIVLKSRSMNIRIDESSYCILIKALCRINKVNHAFGLLVYMIDDGFELDEKM 130 R L MVP I+LKS++MNIR++ESS+ IL+ ALCRI K N+A +L YM++DG+ +D KM Sbjct: 162 REGLVMVPQILLKSQAMNIRLEESSFRILVAALCRIKKHNYAIRILNYMLNDGYAVDAKM 221 Query: 129 CSLILSTLCRQGDLSVDAFTGYLEEMKAYGFCLGRLDWCNVIR 1 CS+ILS+LC Q LS D ++EEM+ GF GR+D NVIR Sbjct: 222 CSIILSSLCEQKGLSGDEVLRFMEEMRKLGFYPGRVDCNNVIR 264 >ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Glycine max] Length = 499 Score = 109 bits (273), Expect = 2e-22 Identities = 51/103 (49%), Positives = 76/103 (73%) Frame = -3 Query: 309 RGWLEMVPDIVLKSRSMNIRIDESSYCILIKALCRINKVNHAFGLLVYMIDDGFELDEKM 130 R LEMVP+I+LKS+ MNIR++ES++ +LI+ALCRI +V +A +L +M++DG+ LDEK+ Sbjct: 167 RDCLEMVPEILLKSQHMNIRVEESTFRVLIRALCRIKRVGYAIKMLNFMVEDGYGLDEKI 226 Query: 129 CSLILSTLCRQGDLSVDAFTGYLEEMKAYGFCLGRLDWCNVIR 1 CSL++S LC Q DL+ +M+ GFC G +D+ N+IR Sbjct: 227 CSLVISALCEQKDLTSAEALVVWRDMRKLGFCPGVMDYTNMIR 269 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] gi|449483740|ref|XP_004156675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] Length = 491 Score = 105 bits (263), Expect = 3e-21 Identities = 50/100 (50%), Positives = 72/100 (72%) Frame = -3 Query: 300 LEMVPDIVLKSRSMNIRIDESSYCILIKALCRINKVNHAFGLLVYMIDDGFELDEKMCSL 121 L ++PDI+L S SM IR++ S++ ILI ALC++NKV HA L YMI +G+ L+ ++CSL Sbjct: 160 LPIIPDIILNSHSMGIRLEHSTFQILITALCKVNKVGHAMELFNYMITEGYGLNPQICSL 219 Query: 120 ILSTLCRQGDLSVDAFTGYLEEMKAYGFCLGRLDWCNVIR 1 IL++LC+Q S D G+LEEM+ GFC +D+ NVI+ Sbjct: 220 ILASLCQQKKSSGDVVLGFLEEMRQKGFCPAVVDYSNVIK 259 >ref|XP_003623530.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498545|gb|AES79748.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 653 Score = 105 bits (263), Expect = 3e-21 Identities = 55/104 (52%), Positives = 77/104 (74%), Gaps = 1/104 (0%) Frame = -3 Query: 309 RGWLEMVPDIVLKSRSMNIRIDESSYCILIKALCRINKVNHAFGLLVYMIDDGFELDEKM 130 R L MVPDI+LKSR M IR++ESS+ +LIKALCRI +V++A ++ M++DG+ LD+K+ Sbjct: 161 RECLRMVPDILLKSRDMKIRLEESSFWVLIKALCRIKRVDYAIKMMNCMVEDGYCLDDKI 220 Query: 129 CSLILSTLCRQGDL-SVDAFTGYLEEMKAYGFCLGRLDWCNVIR 1 CSLI+S+LC Q DL SV+A + M+ GFC G +D N+IR Sbjct: 221 CSLIISSLCEQNDLTSVEALVVW-GNMRKLGFCPGVMDCTNMIR 263 >ref|XP_002533822.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526239|gb|EEF28557.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 373 Score = 103 bits (256), Expect = 2e-20 Identities = 49/99 (49%), Positives = 70/99 (70%) Frame = -3 Query: 300 LEMVPDIVLKSRSMNIRIDESSYCILIKALCRINKVNHAFGLLVYMIDDGFELDEKMCSL 121 L VP+++LKS+ MNIR++ESS+ +LI ALC INKV +A + MI+DGF +D K+CSL Sbjct: 37 LNFVPEVLLKSQDMNIRMEESSFRLLINALCSINKVGYAVEMFNCMINDGFSVDSKICSL 96 Query: 120 ILSTLCRQGDLSVDAFTGYLEEMKAYGFCLGRLDWCNVI 4 +LS+LC Q D+S +L E++ +GFC G D+ VI Sbjct: 97 LLSSLCYQADISSSEVMRFLGELRKFGFCPGIKDYSKVI 135