BLASTX nr result
ID: Angelica22_contig00048152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048152 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172143.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 57 2e-06 ref|XP_004145377.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 57 2e-06 ref|XP_002520991.1| ring finger protein, putative [Ricinus commu... 56 3e-06 >ref|XP_004172143.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Cucumis sativus] Length = 430 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 2/68 (2%) Frame = +1 Query: 1 QKTKDENYSTGVHP--SESRKPKKIQWLHQKKADTFRKAKVSPQTVLDASNIRHEKILNP 174 +K K EN T P E+ KPKK++ + QK+ + + ++PQ VLDAS+ RHE P Sbjct: 263 RKQKRENGKTRADPVSPETEKPKKLRRVRQKRESFYGDSSLTPQVVLDASSARHEIKAGP 322 Query: 175 VWCSLVAS 198 +W SL+AS Sbjct: 323 IWLSLIAS 330 >ref|XP_004145377.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Cucumis sativus] gi|449474218|ref|XP_004154108.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Cucumis sativus] Length = 430 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 2/68 (2%) Frame = +1 Query: 1 QKTKDENYSTGVHP--SESRKPKKIQWLHQKKADTFRKAKVSPQTVLDASNIRHEKILNP 174 +K K EN T P E+ KPKK++ + QK+ + + ++PQ VLDAS+ RHE P Sbjct: 263 RKQKRENGKTRADPVSPETEKPKKLRRVRQKRESFYGDSSLTPQVVLDASSARHEIKAGP 322 Query: 175 VWCSLVAS 198 +W SL+AS Sbjct: 323 IWLSLIAS 330 >ref|XP_002520991.1| ring finger protein, putative [Ricinus communis] gi|223539828|gb|EEF41408.1| ring finger protein, putative [Ricinus communis] Length = 520 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/67 (41%), Positives = 44/67 (65%) Frame = +1 Query: 4 KTKDENYSTGVHPSESRKPKKIQWLHQKKADTFRKAKVSPQTVLDASNIRHEKILNPVWC 183 K +DE + PS++ PK+++ + +KKA F + +S Q VL+A+++ HEK PVW Sbjct: 262 KVEDEKNNIDT-PSDAAGPKRLRRIRRKKAANFGDSGISSQAVLNAASVNHEKRAGPVWF 320 Query: 184 SLVASKD 204 SLVAS+D Sbjct: 321 SLVASED 327