BLASTX nr result
ID: Angelica22_contig00048092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00048092 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192891.1| cysteine/histidine-rich C1 domain-containing pr... 57 1e-06 >ref|NP_192891.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|7267854|emb|CAB78197.1| putative protein [Arabidopsis thaliana] gi|7321051|emb|CAB82159.1| putative protein [Arabidopsis thaliana] gi|332657622|gb|AEE83022.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 525 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/106 (31%), Positives = 47/106 (44%) Frame = -2 Query: 318 CNGCTTSISTSDAVFYECSKCEYILHIHCALFPKEMPLNLEGNLVGIQPSVHDIWSCTCC 139 C+ CT + FY C C++ILH HCA PK+ L + + + V + +SCT C Sbjct: 310 CSACTHPVRLQS--FYACKDCDFILHQHCAESPKKEWHVLHNDRLTLVTCVANFFSCTAC 367 Query: 138 GGFRNGTQMQATYVTHSNSHRIIDAKIDTECALLLPKLIKHEAHPH 1 NG Q ++ K+D C L+ I H HPH Sbjct: 368 SRLSNGFMYQCDFM-----------KLDVLCGLVSEPYI-HPGHPH 401