BLASTX nr result
ID: Angelica22_contig00047971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047971 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein... 66 3e-09 dbj|BAA99575.1| DC2.15 like protein [Daucus carota] 65 8e-09 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum] 60 1e-07 gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii] 59 3e-07 gb|ABQ88334.1| lipid transfer protein [Capsicum annuum] 59 4e-07 >sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor gi|18316|emb|CAA33476.1| unnamed protein product [Daucus carota] Length = 137 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 3 IKANILGIKLNLPIALSLVLNNCGKQVPNGFEC 101 IKANILG LNLPIALSLVLNNCGKQVPNGFEC Sbjct: 104 IKANILGKNLNLPIALSLVLNNCGKQVPNGFEC 136 >dbj|BAA99575.1| DC2.15 like protein [Daucus carota] Length = 127 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 IKANILGIKLNLPIALSLVLNNCGKQVPNGFEC 101 IKANILGI LNLP+ALSLVLNNCGK +PNGFEC Sbjct: 94 IKANILGINLNLPVALSLVLNNCGKTLPNGFEC 126 >dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum] Length = 130 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKANILGIKLNLPIALSLVLNNCGKQVPNGFECP 104 IKANILGI LN+P++LSL+LN CGKQVP+GF+CP Sbjct: 97 IKANILGINLNVPLSLSLLLNVCGKQVPSGFQCP 130 >gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii] Length = 137 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 3 IKANILGIKLNLPIALSLVLNNCGKQVPNGFECP*R 110 IKAN+LGI LN+P++LSL+LN CGK+VP GF+CP R Sbjct: 101 IKANVLGINLNVPVSLSLLLNYCGKKVPTGFQCPSR 136 >gb|ABQ88334.1| lipid transfer protein [Capsicum annuum] Length = 142 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKANILGIKLNLPIALSLVLNNCGKQVPNGFECP 104 +KANILGI LN+PI+LSL+LN CGK+VP+GF+CP Sbjct: 108 LKANILGINLNVPISLSLLLNVCGKKVPSGFQCP 141