BLASTX nr result
ID: Angelica22_contig00047863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047863 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_740175.1| hypothetical protein RF1 [Daucus carota] gi|118... 131 6e-29 ref|YP_004222704.1| hypothetical chloroplast RF19 [Anthriscus ce... 124 6e-27 ref|YP_004935611.1| ycf1 protein (chloroplast) [Eleutherococcus ... 111 5e-23 gb|ADD30906.1| putative RF1 protein [Ilex cornuta] 110 2e-22 gb|ADD30905.1| putative RF1 protein [Ehretia acuminata] 106 2e-21 >ref|YP_740175.1| hypothetical protein RF1 [Daucus carota] gi|118574747|sp|Q0G9Q4.1|YCF1_DAUCA RecName: Full=Putative membrane protein ycf1 gi|113200966|gb|ABI32482.1| hypothetical protein RF1 [Daucus carota] Length = 1826 Score = 131 bits (329), Expect = 6e-29 Identities = 66/94 (70%), Positives = 68/94 (72%) Frame = -3 Query: 282 KIEKMDKNDIFYLMIHQNLEINPINDKKLFFDWMEMNEEILNSISTNLKLPFFPEFVPLY 103 KI KMDKN I L IHQ+LE NPINDKK+FFDWMEMNEEILN ISTNLKL FFPEFVPLY Sbjct: 1431 KIYKMDKNAILSLTIHQDLERNPINDKKIFFDWMEMNEEILNPISTNLKLTFFPEFVPLY 1490 Query: 102 NVYKIKPWIIPSXXXXXXXXXXXXXXXXXKFHFF 1 NVYK KPWIIPS KFHFF Sbjct: 1491 NVYKTKPWIIPSKLLLLNLNKKKNINENKKFHFF 1524 >ref|YP_004222704.1| hypothetical chloroplast RF19 [Anthriscus cerefolium] gi|289645633|gb|ADD13696.1| hypothetical chloroplast RF19 [Anthriscus cerefolium] Length = 1793 Score = 124 bits (312), Expect = 6e-27 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = -3 Query: 276 EKMDKNDIFYLMIHQNLEINPINDKKLFFDWMEMNEEILNSISTNLKLPFFPEFVPLYNV 97 +K+DKN+IFYL I Q+LE NPINDKKLFFDWMEMNEEILN ISTNLKL FFPEFVPL NV Sbjct: 1398 QKIDKNNIFYLPIDQDLERNPINDKKLFFDWMEMNEEILNPISTNLKLKFFPEFVPLLNV 1457 Query: 96 YKIKPWIIPS 67 YK KPWIIPS Sbjct: 1458 YKKKPWIIPS 1467 >ref|YP_004935611.1| ycf1 protein (chloroplast) [Eleutherococcus senticosus] gi|347448265|gb|AEO92677.1| ycf1 protein (chloroplast) [Eleutherococcus senticosus] Length = 1875 Score = 111 bits (278), Expect = 5e-23 Identities = 52/72 (72%), Positives = 61/72 (84%) Frame = -3 Query: 282 KIEKMDKNDIFYLMIHQNLEINPINDKKLFFDWMEMNEEILNSISTNLKLPFFPEFVPLY 103 KI+K+ KND+FYL ++Q+LE NP+N KK FFDWMEMNEEILN +NL+L FFPEFV LY Sbjct: 1453 KIDKIHKNDLFYLTLYQDLEKNPLNQKKHFFDWMEMNEEILNRHISNLELWFFPEFVLLY 1512 Query: 102 NVYKIKPWIIPS 67 NVYK KPWIIPS Sbjct: 1513 NVYKKKPWIIPS 1524 >gb|ADD30906.1| putative RF1 protein [Ilex cornuta] Length = 1897 Score = 110 bits (274), Expect = 2e-22 Identities = 51/71 (71%), Positives = 59/71 (83%) Frame = -3 Query: 279 IEKMDKNDIFYLMIHQNLEINPINDKKLFFDWMEMNEEILNSISTNLKLPFFPEFVPLYN 100 I+K+DK +FYL IHQ+LEINP N KK+FFDWM MNEEILN +NL+L FFPEFV LYN Sbjct: 1475 IDKIDKKGLFYLTIHQDLEINPPNHKKIFFDWMGMNEEILNCPISNLELWFFPEFVLLYN 1534 Query: 99 VYKIKPWIIPS 67 YK+KPWIIPS Sbjct: 1535 AYKMKPWIIPS 1545 >gb|ADD30905.1| putative RF1 protein [Ehretia acuminata] Length = 1814 Score = 106 bits (265), Expect = 2e-21 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = -3 Query: 279 IEKMDKNDIFYLMIHQNLEINPINDKKLFFDWMEMNEEILNSISTNLKLPFFPEFVPLYN 100 I+K+DK D+FYL IHQ+ +IN IN +K+ FDWMEMNEEILN +NL+L FFPEFV LYN Sbjct: 1398 IDKIDKKDLFYLTIHQDPKINSINPQKVLFDWMEMNEEILNRPISNLELWFFPEFVRLYN 1457 Query: 99 VYKIKPWIIPS 67 YK+KPW+IPS Sbjct: 1458 AYKMKPWVIPS 1468