BLASTX nr result
ID: Angelica22_contig00047765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047765 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulga... 63 2e-08 emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulga... 62 4e-08 emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulga... 59 4e-07 >emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1355 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -2 Query: 290 WSHVKRSGNRVAHTLGGLLPFGSEQVWVNHCPGDVSELVLAEKLSL 153 WSHVKR GN VAH L L+PFG EQVW NH P +V+ VL + LSL Sbjct: 1309 WSHVKRDGNYVAHHLAKLIPFGVEQVWENHFPPEVAPYVLMDNLSL 1354 >emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1355 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -2 Query: 290 WSHVKRSGNRVAHTLGGLLPFGSEQVWVNHCPGDVSELVLAEKLSLN 150 WSHVKR N VAH L L PFG EQ+W NH P +V+ VL + LSLN Sbjct: 1309 WSHVKRDANSVAHHLAKLTPFGIEQIWENHVPPEVAPYVLMDNLSLN 1355 >emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1357 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -2 Query: 290 WSHVKRSGNRVAHTLGGLLPFGSEQVWVNHCPGDVSELVLAEKLSL 153 +SHVKR GN VAH L ++PFG EQ W +HCP V+ VL + LSL Sbjct: 1312 FSHVKRDGNTVAHNLARVVPFGVEQCWEHHCPSSVTPYVLMDTLSL 1357