BLASTX nr result
ID: Angelica22_contig00047764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047764 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO32530.1| cytochrome P450-dependent monooxygenase-like prot... 93 2e-17 ref|XP_003610581.1| Cytochrome P450 [Medicago truncatula] gi|355... 70 2e-10 gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum] 69 3e-10 ref|XP_002522903.1| cytochrome P450, putative [Ricinus communis]... 69 4e-10 ref|XP_002522900.1| cytochrome P450, putative [Ricinus communis]... 69 4e-10 >gb|ABO32530.1| cytochrome P450-dependent monooxygenase-like protein [Ammi majus] Length = 507 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +2 Query: 2 PLAQMLYHFDWTLPDGMKPADLDMDETFGATTKRKNSLFLNATPYISTLED 154 PLAQ+LYHFDWTLP+GMKP DLDMDETFGATTKRKNSL LN T +IS+LE+ Sbjct: 457 PLAQLLYHFDWTLPNGMKPEDLDMDETFGATTKRKNSLVLNVTSHISSLEE 507 >ref|XP_003610581.1| Cytochrome P450 [Medicago truncatula] gi|355511636|gb|AES92778.1| Cytochrome P450 [Medicago truncatula] Length = 389 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +2 Query: 2 PLAQMLYHFDWTLPDGMKPADLDMDETFGATTKRKNSLFLNATPYI 139 PLA +LYHF+W LP+GMKP DLDM E FGA R+N+L+L TPYI Sbjct: 344 PLAALLYHFNWELPNGMKPEDLDMTEAFGAVVARRNNLYLIPTPYI 389 >gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum] Length = 504 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +2 Query: 2 PLAQMLYHFDWTLPDGMKPADLDMDETFGATTKRKNSLFLNATPY 136 PLAQ+LYHFDW LP G+KP DLD+ E G T RK L+LNATPY Sbjct: 455 PLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYLNATPY 499 >ref|XP_002522903.1| cytochrome P450, putative [Ricinus communis] gi|223537888|gb|EEF39503.1| cytochrome P450, putative [Ricinus communis] Length = 532 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +2 Query: 2 PLAQMLYHFDWTLPDGMKPADLDMDETFGATTKRKNSLFLNATPY 136 PLAQ+LYHFDW LPDG+ P DLDM ETFGAT RKN L + T Y Sbjct: 472 PLAQLLYHFDWKLPDGIAPEDLDMTETFGATITRKNKLHVIPTRY 516 >ref|XP_002522900.1| cytochrome P450, putative [Ricinus communis] gi|223537885|gb|EEF39500.1| cytochrome P450, putative [Ricinus communis] Length = 221 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +2 Query: 2 PLAQMLYHFDWTLPDGMKPADLDMDETFGATTKRKNSLFLNATPY 136 PLAQ+LYHFDW LPDG+ P DLDM ETFGAT RKN L + T Y Sbjct: 161 PLAQLLYHFDWKLPDGVAPEDLDMTETFGATITRKNKLHVIPTRY 205