BLASTX nr result
ID: Angelica22_contig00047548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047548 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279127.2| PREDICTED: probable inactive receptor kinase... 64 1e-08 emb|CBI15604.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002533427.1| ATP binding protein, putative [Ricinus commu... 62 5e-08 ref|XP_002322122.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_004163815.1| PREDICTED: probable inactive receptor kinase... 60 1e-07 >ref|XP_002279127.2| PREDICTED: probable inactive receptor kinase At1g48480-like [Vitis vinifera] Length = 672 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -3 Query: 244 VQLLQLAMDCAAQFPDQRPSVSEVTRQIEALCRPHVLEGQNPEP 113 VQLLQLA+DC AQ+PD+RP +SEVT++IE LCR + E Q+P+P Sbjct: 617 VQLLQLAIDCTAQYPDKRPPISEVTKRIEELCRSSLREYQDPQP 660 >emb|CBI15604.3| unnamed protein product [Vitis vinifera] Length = 190 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -3 Query: 244 VQLLQLAMDCAAQFPDQRPSVSEVTRQIEALCRPHVLEGQNPEP 113 VQLLQLA+DC AQ+PD+RP +SEVT++IE LCR + E Q+P+P Sbjct: 135 VQLLQLAIDCTAQYPDKRPPISEVTKRIEELCRSSLREYQDPQP 178 >ref|XP_002533427.1| ATP binding protein, putative [Ricinus communis] gi|223526727|gb|EEF28958.1| ATP binding protein, putative [Ricinus communis] Length = 661 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 244 VQLLQLAMDCAAQFPDQRPSVSEVTRQIEALCRPHVLEGQNPEP 113 VQLLQL +DCAAQ+PD RPS+SEVT +IE L R + E Q+PEP Sbjct: 607 VQLLQLGIDCAAQYPDNRPSMSEVTNRIEELRRSSIREDQDPEP 650 >ref|XP_002322122.1| predicted protein [Populus trichocarpa] gi|222869118|gb|EEF06249.1| predicted protein [Populus trichocarpa] Length = 652 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 244 VQLLQLAMDCAAQFPDQRPSVSEVTRQIEALCRPHVLEGQNPEP 113 VQLLQL +DCAAQ+PD RPS+S VTR+IE LCR + E P+P Sbjct: 597 VQLLQLGIDCAAQYPDNRPSMSAVTRRIEELCRSSLREHHGPQP 640 >ref|XP_004163815.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cucumis sativus] Length = 694 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -3 Query: 244 VQLLQLAMDCAAQFPDQRPSVSEVTRQIEALCRPHVLEGQNPEP 113 VQLLQLA+DCAAQ+PD+RPS+SEVT++IE L + + E NP+P Sbjct: 639 VQLLQLAVDCAAQYPDKRPSMSEVTKRIEELRQSSLHEAVNPQP 682