BLASTX nr result
ID: Angelica22_contig00047533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047533 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529992.1| ATP binding protein, putative [Ricinus commu... 55 8e-06 >ref|XP_002529992.1| ATP binding protein, putative [Ricinus communis] gi|223530515|gb|EEF32397.1| ATP binding protein, putative [Ricinus communis] Length = 978 Score = 54.7 bits (130), Expect = 8e-06 Identities = 34/76 (44%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = -3 Query: 238 LPNYITEMYSLQTL---RVWKLEKLPKQFCNLINLRHLVIENKYMKRSSRTRCMFVGIER 68 LP I ++++LQTL R +LE+LP+ LINLRHLVI + R + M G+E Sbjct: 495 LPGCICDLHNLQTLLLSRCERLEQLPRDIRKLINLRHLVI-----IKCPRLQHMPQGLEE 549 Query: 67 LIFLQTLPHFVVSRDQ 20 L FL+TL F+V RD+ Sbjct: 550 LTFLRTLSRFIVPRDK 565