BLASTX nr result
ID: Angelica22_contig00047409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047409 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36735.1| HSF domain class transcription factor [Malus x do... 89 3e-16 emb|CBI19505.3| unnamed protein product [Vitis vinifera] 89 5e-16 gb|ABK95877.1| unknown [Populus trichocarpa] 89 5e-16 ref|XP_002284836.1| PREDICTED: heat stress transcription factor ... 89 5e-16 ref|XP_003603058.1| Heat stress transcription factor B-4 [Medica... 87 1e-15 >gb|ADL36735.1| HSF domain class transcription factor [Malus x domestica] Length = 383 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 141 ALMLDNCESILLSLDSHKSVPAPFLTKSYQLVDVPLTDHIVSWGDD 4 ALM+DNCE ILLSLDSHKSVPAPFLTK+YQLVD P TDHIVSWGDD Sbjct: 2 ALMIDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGDD 47 >emb|CBI19505.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 141 ALMLDNCESILLSLDSHKSVPAPFLTKSYQLVDVPLTDHIVSWGDD 4 ALMLDNCE ILLSLDSHKSVPAPFLTK+YQLVD P TDHIVSWG+D Sbjct: 2 ALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGED 47 >gb|ABK95877.1| unknown [Populus trichocarpa] Length = 368 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 141 ALMLDNCESILLSLDSHKSVPAPFLTKSYQLVDVPLTDHIVSWGDD 4 ALMLDNCE ILLSLDSHKSVPAPFLTK+YQLVD P TDHIVSWG+D Sbjct: 2 ALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGED 47 >ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|147768919|emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera] Length = 363 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 141 ALMLDNCESILLSLDSHKSVPAPFLTKSYQLVDVPLTDHIVSWGDD 4 ALMLDNCE ILLSLDSHKSVPAPFLTK+YQLVD P TDHIVSWG+D Sbjct: 2 ALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGED 47 >ref|XP_003603058.1| Heat stress transcription factor B-4 [Medicago truncatula] gi|355492106|gb|AES73309.1| Heat stress transcription factor B-4 [Medicago truncatula] Length = 373 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 141 ALMLDNCESILLSLDSHKSVPAPFLTKSYQLVDVPLTDHIVSWGDD 4 AL+LDNCE ILLSLDSHKSVPAPFLTK+YQLVD P TDHIVSWG+D Sbjct: 2 ALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGED 47