BLASTX nr result
ID: Angelica22_contig00047344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047344 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528019.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 >ref|XP_002528019.1| conserved hypothetical protein [Ricinus communis] gi|223532549|gb|EEF34337.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/80 (36%), Positives = 50/80 (62%) Frame = +1 Query: 1 AVVHKHLVSRFRNRVTKGLVYNLRNVKIATNIYPYRPLASNLRLLFLATTNVEAVGEGVA 180 A+V K+L++RF++ + +G +Y ++N K++ YRP+ +NLR+ FL +E V + Sbjct: 33 AIVRKNLINRFKS-LLQGAIYIIKNPKVSETFGDYRPVKNNLRVYFLLIITLEEVQDSTT 91 Query: 181 CIPRYGFQFVNQVALRSRAD 240 IPR+GF+F N + R D Sbjct: 92 KIPRHGFEFANLETIDGRVD 111