BLASTX nr result
ID: Angelica22_contig00047272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047272 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527837.1| conserved hypothetical protein [Ricinus comm... 65 4e-09 ref|XP_002331080.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 >ref|XP_002527837.1| conserved hypothetical protein [Ricinus communis] gi|223532761|gb|EEF34540.1| conserved hypothetical protein [Ricinus communis] Length = 161 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 4/84 (4%) Frame = +1 Query: 1 FRSDFPWEQNDIDPDPEIKXXXXXXXXXXXXXXYQQYMLPNPVYGMPVVP----RERSVG 168 ++S F + +I + + YQQY +PNPVYG+PVV RERS G Sbjct: 77 YQSQFQFPSQEIVVETDTNAIYPTLPNTDTPLTYQQYAVPNPVYGVPVVEQTPRRERSAG 136 Query: 169 VFGCVFNVGKHLLRLACPCFRIKQ 240 FGC G +L+R CPCF I++ Sbjct: 137 FFGCFVKFGANLIRCFCPCFHIRE 160 >ref|XP_002331080.1| predicted protein [Populus trichocarpa] gi|222872808|gb|EEF09939.1| predicted protein [Populus trichocarpa] Length = 213 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +1 Query: 100 YQQYMLPNPVYGMPVVP---RERSVGVFGCVFNVGKHLLRLACPCFRIKQ 240 YQQY++PNPVYG+PV RE+S G FGCV +L+R CPCFRI++ Sbjct: 105 YQQYLVPNPVYGVPVEQKPRREKSTGFFGCVVTFCANLIRCFCPCFRIQE 154