BLASTX nr result
ID: Angelica22_contig00047152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047152 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72645.1| hypothetical protein VITISV_007503 [Vitis vinifera] 84 9e-15 ref|XP_002262617.2| PREDICTED: G-type lectin S-receptor-like ser... 82 4e-14 emb|CAN79929.1| hypothetical protein VITISV_007487 [Vitis vinifera] 81 1e-13 emb|CBI17991.3| unnamed protein product [Vitis vinifera] 80 1e-13 ref|XP_003633326.1| PREDICTED: G-type lectin S-receptor-like ser... 78 6e-13 >emb|CAN72645.1| hypothetical protein VITISV_007503 [Vitis vinifera] Length = 1000 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/58 (65%), Positives = 46/58 (79%) Frame = -3 Query: 209 DTGNLVLIDDRTSSIVWESFNHSTDTFLPGMKMDENLNLTSWTSDKDPALGNYSFTPD 36 D+GNLVL D+R+ I+WESF++ TDTFLPGMKMDENL LTSW DPA GN++F D Sbjct: 136 DSGNLVLSDNRSGVILWESFHNPTDTFLPGMKMDENLTLTSWRGSDDPAPGNFTFKLD 193 >ref|XP_002262617.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230-like [Vitis vinifera] Length = 1585 Score = 82.0 bits (201), Expect = 4e-14 Identities = 38/58 (65%), Positives = 45/58 (77%) Frame = -3 Query: 209 DTGNLVLIDDRTSSIVWESFNHSTDTFLPGMKMDENLNLTSWTSDKDPALGNYSFTPD 36 D+GNLVL +R+ I+WESF++ TDTFLPGMKMDE L LTSW S DPA GNY+F D Sbjct: 705 DSGNLVLSYNRSGKILWESFHNPTDTFLPGMKMDETLTLTSWLSSVDPAPGNYTFKID 762 >emb|CAN79929.1| hypothetical protein VITISV_007487 [Vitis vinifera] Length = 915 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -3 Query: 209 DTGNLVLIDDRTSSIVWESFNHSTDTFLPGMKMDENLNLTSWTSDKDPALGNYSFTPD 36 D+ NLVL D+R+ I+WESF++ TDTFLPGMKMDENL LTSW S DP GN++F D Sbjct: 142 DSRNLVLSDNRSGVILWESFHNPTDTFLPGMKMDENLTLTSWLSSVDPTPGNFTFKLD 199 >emb|CBI17991.3| unnamed protein product [Vitis vinifera] Length = 1130 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/64 (57%), Positives = 45/64 (70%) Frame = -3 Query: 209 DTGNLVLIDDRTSSIVWESFNHSTDTFLPGMKMDENLNLTSWTSDKDPALGNYSFTPDGV 30 D+GN VL D+R+ I+WESF + TDTFLPGM M+ NL LTSW S DPA GNY+F D Sbjct: 570 DSGNFVLSDNRSGKILWESFKNPTDTFLPGMIMEGNLTLTSWVSPVDPAPGNYTFKKDDD 629 Query: 29 YSEY 18 +Y Sbjct: 630 KDQY 633 >ref|XP_003633326.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230-like [Vitis vinifera] Length = 1379 Score = 78.2 bits (191), Expect = 6e-13 Identities = 36/64 (56%), Positives = 45/64 (70%) Frame = -3 Query: 209 DTGNLVLIDDRTSSIVWESFNHSTDTFLPGMKMDENLNLTSWTSDKDPALGNYSFTPDGV 30 D+GN VL D+R+ I+WESF + TDTFLPGM M+ NL LTSW S DPA G+Y+F D Sbjct: 507 DSGNFVLRDNRSGKILWESFKNPTDTFLPGMIMEGNLTLTSWVSPVDPAPGSYTFKQDDD 566 Query: 29 YSEY 18 +Y Sbjct: 567 KDQY 570