BLASTX nr result
ID: Angelica22_contig00047149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047149 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75298.1| hypothetical protein VITISV_008675 [Vitis vinifera] 55 4e-06 >emb|CAN75298.1| hypothetical protein VITISV_008675 [Vitis vinifera] Length = 445 Score = 55.5 bits (132), Expect = 4e-06 Identities = 42/119 (35%), Positives = 56/119 (47%), Gaps = 2/119 (1%) Frame = +1 Query: 1 PTIRSQGSRCLAPANPFAKEDRRDSTSIMNIFNHGFVDFMPSGLNLQVTK*LETGE--WR 174 PTI SQG+R LAPANPFAKE VTK + T W+ Sbjct: 353 PTINSQGNRYLAPANPFAKE---------------------------VTKRVITSNSVWK 385 Query: 175 HWN*MSEK*SEAERSLLHCILKRSCSQLCKSIKLRCRTLPSVIVSMTSGAGALNCRRGR 351 HWN SE + + + ++ L ++ S++ +MTSGAGAL+CRRGR Sbjct: 386 HWNWRSEGDLLLNGAYFTPSGAGAAASYARASSLGAKS-SSMVGTMTSGAGALSCRRGR 443