BLASTX nr result
ID: Angelica22_contig00047121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047121 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 117 IAPVSRPGILHLAFMISTFNCAPETGSKHAPAQC 16 +A VSRPGILHLAFMISTF CAPET SKHA C Sbjct: 757 VARVSRPGILHLAFMISTFRCAPETRSKHARPVC 790