BLASTX nr result
ID: Angelica22_contig00047046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00047046 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW60928.1| hypothetical protein ZEAMMB73_786393 [Zea mays] 57 1e-06 >gb|AFW60928.1| hypothetical protein ZEAMMB73_786393 [Zea mays] Length = 316 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 70 QKNNCLEHQRLNDLVHGK*NPKIETRFRKHSAEGKDSAPLVLEDFRWEN 216 +K N LEH+RLNDLV+ N K+ RF+K EGK+ PL+LEDF W+N Sbjct: 155 KKRNRLEHKRLNDLVYVSYNKKMADRFQKIREEGKNFDPLILEDFDWDN 203