BLASTX nr result
ID: Angelica22_contig00046701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046701 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-15 emb|CBI15606.3| unnamed protein product [Vitis vinifera] 84 9e-15 ref|XP_002520332.1| pentatricopeptide repeat-containing protein,... 83 3e-14 ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 ref|XP_003553291.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 >ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Vitis vinifera] Length = 432 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/77 (51%), Positives = 57/77 (74%) Frame = +1 Query: 1 LCEAGRVKESWDSLVQLVESGSIPREYTYRLVCELLKSKGEANLLDEKLCRRIEEGIKVR 180 LCE GR+ E+ D L++LV+ GS+PREYTY++VC+ L+S GEAN+L ++L RIE GI+ R Sbjct: 356 LCETGRILEARDFLIELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENR 415 Query: 181 CRDVMLIKPIKSQNIYL 231 + VM +K I + I L Sbjct: 416 YKQVMKVKLIMTHRISL 432 >emb|CBI15606.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/77 (51%), Positives = 57/77 (74%) Frame = +1 Query: 1 LCEAGRVKESWDSLVQLVESGSIPREYTYRLVCELLKSKGEANLLDEKLCRRIEEGIKVR 180 LCE GR+ E+ D L++LV+ GS+PREYTY++VC+ L+S GEAN+L ++L RIE GI+ R Sbjct: 305 LCETGRILEARDFLIELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENR 364 Query: 181 CRDVMLIKPIKSQNIYL 231 + VM +K I + I L Sbjct: 365 YKQVMKVKLIMTHRISL 381 >ref|XP_002520332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540551|gb|EEF42118.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 441 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/70 (57%), Positives = 52/70 (74%) Frame = +1 Query: 1 LCEAGRVKESWDSLVQLVESGSIPREYTYRLVCELLKSKGEANLLDEKLCRRIEEGIKVR 180 LCEA RV E+ D L++LV+ GSIPREYTY+LVCE +KS E NL+D++ RI++GI R Sbjct: 365 LCEADRVLEARDFLLELVDGGSIPREYTYKLVCETMKSAREVNLIDDEFHNRIKDGIDER 424 Query: 181 CRDVMLIKPI 210 R V +KPI Sbjct: 425 FRQVKKVKPI 434 >ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] gi|449518241|ref|XP_004166151.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] Length = 445 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/76 (53%), Positives = 55/76 (72%) Frame = +1 Query: 1 LCEAGRVKESWDSLVQLVESGSIPREYTYRLVCELLKSKGEANLLDEKLCRRIEEGIKVR 180 LCE G+V E+ D L++L+E GS+PREYTY+LVC LL S G+A+LLDE + RI GI+ R Sbjct: 370 LCEGGKVIEARDFLLELLEEGSVPREYTYQLVCNLLNSAGKASLLDENVHERIRHGIENR 429 Query: 181 CRDVMLIKPIKSQNIY 228 R+V +K I S+ Y Sbjct: 430 YREVKKVKLIMSRKGY 445 >ref|XP_003553291.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Glycine max] Length = 732 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 2/78 (2%) Frame = +1 Query: 1 LCEAGRVKESWDSLVQLVESGSIPREYTYRLVCELLKSKGEANLLDEK--LCRRIEEGIK 174 LCEAGRV E+W LV+LVE GS+PREYTY LVC+ L++ GE LL++ + +RI++GI Sbjct: 648 LCEAGRVVEAWWFLVELVEGGSVPREYTYGLVCDRLRAAGEGGLLEDHDGVHKRIKDGIW 707 Query: 175 VRCRDVMLIKPIKSQNIY 228 R R +M +KP+ ++ Y Sbjct: 708 NRYRQMMKVKPVMARKGY 725