BLASTX nr result
ID: Angelica22_contig00046663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046663 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP82795.1| resistance protein RPP8-like protein [Arabidopsis... 55 8e-06 >gb|AAP82795.1| resistance protein RPP8-like protein [Arabidopsis thaliana] gi|32453329|gb|AAP82796.1| resistance protein RPP8-like protein [Arabidopsis thaliana] Length = 503 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/50 (44%), Positives = 33/50 (66%) Frame = +1 Query: 7 DDDEYYTVRQVLGFSYDNLPSRLRQCFLCFAIYKEDEVIKTHELYMFWMA 156 DD+ +V ++L SY++LP+ L+ CFLC A + ED I HEL+ +W A Sbjct: 26 DDNSLNSVYRILSLSYEDLPTHLKHCFLCLAHFPEDSKIYRHELFYYWAA 75