BLASTX nr result
ID: Angelica22_contig00046624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046624 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521845.1| conserved hypothetical protein [Ricinus comm... 79 5e-13 ref|XP_002330279.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera] 72 6e-11 ref|XP_003518857.1| PREDICTED: uncharacterized protein LOC100804... 69 4e-10 ref|XP_002313092.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 >ref|XP_002521845.1| conserved hypothetical protein [Ricinus communis] gi|223538883|gb|EEF40481.1| conserved hypothetical protein [Ricinus communis] Length = 129 Score = 78.6 bits (192), Expect = 5e-13 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 53 MVGRLCSGRKIMGHGQYDFESWVETKFATCLDGRVDPGPTR 175 M+GRLCSGR++MGHGQYDFE WVE K ++CLDGRVDP PTR Sbjct: 50 MIGRLCSGRRVMGHGQYDFEGWVERKCSSCLDGRVDPPPTR 90 >ref|XP_002330279.1| predicted protein [Populus trichocarpa] gi|222871314|gb|EEF08445.1| predicted protein [Populus trichocarpa] Length = 133 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 53 MVGRLCSGRKIMGHGQYDFESWVETKFATCLDGRVDPGPTR 175 M+GRLCSGR+I+GHGQYDFE WVE K ++CLDG VDP PTR Sbjct: 54 MIGRLCSGRRILGHGQYDFEGWVERKCSSCLDGHVDPPPTR 94 >emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera] Length = 941 Score = 71.6 bits (174), Expect = 6e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 53 MVGRLCSGRKIMGHGQYDFESWVETKFATCLDGRVDPGP 169 M+GRLCSGR+IMGHGQYD E WVE K ++C+DGRVDP P Sbjct: 860 MIGRLCSGRRIMGHGQYDVEGWVERKCSSCIDGRVDPPP 898 >ref|XP_003518857.1| PREDICTED: uncharacterized protein LOC100804641 [Glycine max] Length = 130 Score = 68.9 bits (167), Expect = 4e-10 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +2 Query: 53 MVGRLCSGRKIMGHGQYDFESWVETKFATCLDGRVDPGPTR 175 M+GRLCSGR++MGHG++D E+WVETK ++C+DGR+ P P R Sbjct: 47 MIGRLCSGRRVMGHGEFDVETWVETKCSSCVDGRIAPPPPR 87 >ref|XP_002313092.1| predicted protein [Populus trichocarpa] gi|222849500|gb|EEE87047.1| predicted protein [Populus trichocarpa] Length = 114 Score = 68.9 bits (167), Expect = 4e-10 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 53 MVGRLCSGRKIMGHGQYDFESWVETKFATCLDGRVDPGPTR 175 M+GR CSGR+++GHGQYD E WVE K ++CLDG V P PTR Sbjct: 37 MIGRFCSGRRVLGHGQYDLEGWVERKCSSCLDGHVGPPPTR 77