BLASTX nr result
ID: Angelica22_contig00046510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046510 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446100.1| hypothetical protein SORBIDRAFT_06g001780 [S... 59 3e-07 ref|XP_002447492.1| hypothetical protein SORBIDRAFT_06g001900 [S... 58 8e-07 >ref|XP_002446100.1| hypothetical protein SORBIDRAFT_06g001780 [Sorghum bicolor] gi|241937283|gb|EES10428.1| hypothetical protein SORBIDRAFT_06g001780 [Sorghum bicolor] Length = 560 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +3 Query: 147 LCVYKDALISGLRFPVHPFIIRLLSEVKVNPCQLYPNSWNIIYIFMQRC 293 LC+Y DAL +GLRFP+H F ++LL ++ P QL PN+W + F+ RC Sbjct: 91 LCIYSDALEAGLRFPLHDFYLKLLRHYRLAPSQLVPNAWKYMAAFVLRC 139 >ref|XP_002447492.1| hypothetical protein SORBIDRAFT_06g001900 [Sorghum bicolor] gi|241938675|gb|EES11820.1| hypothetical protein SORBIDRAFT_06g001900 [Sorghum bicolor] Length = 516 Score = 58.2 bits (139), Expect = 8e-07 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = +3 Query: 147 LCVYKDALISGLRFPVHPFIIRLLSEVKVNPCQLYPNSWNIIYIFMQRC 293 LC+Y DA+ +GLRFP+H F ++LL ++ P QL PN+W + F+ RC Sbjct: 101 LCIYSDAVDAGLRFPLHDFYLKLLRHYRLAPTQLVPNAWKYMAAFVLRC 149